KEGG   Chlamydia psittaci CP3: B711_0793Help
Entry
B711_0793         CDS       T02251                                 

Definition
(GenBank) hypothetical protein
Organism
cpsc  Chlamydia psittaci CP3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PsbP
Motif
Other DBs
NCBI-ProteinID: AFS27186
Position
788674..789426
Genome map
AA seq 250 aa AA seqDB search
MKLHALVSFLFTSLSLTISANPQTQSTAKPAQKRPSSVSQRRALKKSQSSISNATASHYV
AKRAHKSRRTTQQTKEKSSISWVTYSTDEYTIRIPNNWQCINDKTQLPEKLDVVFIGQGT
GSLTPTINISQEIISKNQPEYIEEILAYHKANDMTLESSVFTHIQSLHGEFTIIKTEKNS
SWGKVFCLQGVAVINHKAYIFTSTATLDDSPNVSLIFLKTVSSFKLSEKEATSGDTILRE
ALKALQEEIE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcacgctcttgtttcttttctgtttactagtttgtctcttacaataagcgca
aatcctcaaacacaaagtacagcaaaacctgcccagaaacgtccctcgagcgtttctcaa
cgaagagcgttgaaaaaatcacaatctagtatttctaatgcaacagcttctcactacgtt
gcaaaaagagcgcataaaagtcgaagaacaacacaacaaacgaaagaaaaatcatcaatt
tcttgggttacctactctacagatgagtatactattcgcatcccgaataactggcagtgc
ataaatgataaaacacaactgcctgaaaaacttgatgtcgtatttattggccaagggaca
ggctcgttaacacccacgatcaacatttctcaagaaattatatctaagaatcaacctgaa
tacattgaagagatacttgcttatcacaaagccaatgacatgacactagaatcttctgta
ttcactcatattcaatctcttcatggagaattcacaattatcaaaacagaaaagaattct
tcgtggggcaaggttttctgccttcaaggcgttgctgtcatcaatcacaaagcctatatt
tttacaagcaccgctaccttagatgactctcctaatgtatctttgattttcttaaagacg
gtgtcttcctttaagctttcagaaaaagaagctacttctggggatactatccttagagag
gctcttaaagccttacaagaagaaatagaataa

DBGET integrated database retrieval system