KEGG   Chlamydia psittaci CP3: B711_0811Help
Entry
B711_0811         CDS       T02251                                 

Definition
(GenBank) hypothetical protein
Organism
cpsc  Chlamydia psittaci CP3
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFS27201
Position
805867..805998
Genome map
AA seq 43 aa AA seqDB search
MNTWYFLEARNKPHDMTLGELLGNGITMHSWAGIIIGMIVNDS
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
atgaacacttggtattttctagaagctcgcaacaaacctcatgatatgactttaggcgag
cttctagggaacggaataaccatgcactcatgggcaggcattataataggaatgattgta
aatgactcttag

DBGET integrated database retrieval system