KEGG   Chlamydia psittaci CP3: B711_0812Help
Entry
B711_0812         CDS       T02251                                 

Definition
(GenBank) bioY family protein
  KO
K03523  biotin transport system substrate-specific component
Organism
cpsc  Chlamydia psittaci CP3
Pathway
cpsc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    B711_0812
Transporters [BR:cpsc02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Biotin transporter [MD:M00581] [OT]
    B711_0812
   Energy-coupling factor transporter [MD:M00582] [OT]
    Substrate-specific components
     B711_0812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BioY DUF5422 ExoD
Motif
Other DBs
NCBI-ProteinID: AFS27202
Position
complement(806112..806702)
Genome map
AA seq 196 aa AA seqDB search
MGYSLATKSHLLRILNSPIVKILEGSLFLALLAKIALPLPFTPILVTFQTLGIFCIGIAY
SPRIALGSVLSYLVAGMFLPVFYGSGCGLTTFFGATAGYLYAFPIAALFISSLYRRFKSP
SGYVLASILTIAALIILVMGSLWLAYYFYMMSITESIDVVKGFQLGAVPFIAGEALKILL
VVKGKSAVQFFQKHYF
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgggttatagcttagctacaaagtctcatctgttaagaattttgaacagtccaatagtc
aaaatactggagggatctcttttcctcgccttattagcgaagattgccctacccctaccc
tttacccctattctcgtcacttttcagacattagggattttctgtataggtattgcatac
tctccacggatagctctcggtagtgtgctctcttatcttgttgccgggatgtttttgcca
gtattttatggttcgggatgtggcttaaccacgtttttcggcgcaacagctggatatctt
tacgcttttcctatcgctgctctatttatctcctcactctatcgtcggtttaaatctccc
agtggatacgtcttggcttctattcttactatcgcagccctgataatactagtgatggga
tctctttggcttgcctactatttttatatgatgtctattacggaatccatagatgttgta
aagggcttccaactaggtgctgtgccatttattgccggagaagccttaaaaatccttctc
gtagttaaaggcaaatcggcggtgcagttttttcagaagcactatttttaa

DBGET integrated database retrieval system