KEGG   Chlamydia psittaci CP3: B711_0815Help
Entry
B711_0815         CDS       T02251                                 

Definition
(GenBank) hypothetical protein
Organism
cpsc  Chlamydia psittaci CP3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF687
Motif
Other DBs
NCBI-ProteinID: AFS27205
Position
complement(809392..811083)
Genome map
AA seq 563 aa AA seqDB search
MIVTVNLDGNSSLENISLGDYHPPSAGDDVSLSQQTSERVDCFIHGGCGSDVMEQPEVFE
AVSIFDPNAEIPRAHEVCVTYVNGSFQTLLEAQHESLYLSEVRGEPVRLLYNSGWGGGEG
RSRLLRRPVVSCSSPLCQALIESLKYFFSHPDNQHRHHTIIFYGDGGAIVNEVLRHVPYG
DRVRVIGIAPKTYVTGSNAAHFRVSGDMTTLLDSAGFARANVTTLAYSSGAEGLFLPSLR
CPSYVWALRLAHHSSSGESSSESMLPLASNQISLVEIGHGQGAFERLSELLQLGETSSEV
EFNFTPQSRSDILLSSIFCIFRVCGLLQEYIIVSVTYAPDVYVSYVIIFGYTLNLLRYFL
LLLTNRRSVRDAYRSLRLIAHGLTPLIFLVTIVDNLNCVRRYGNPFPILQAIFVVASTLS
GSVIFMELLRNCFRGLRGRIQTTILQRLTGAPQESQVVVRSVDGNRIGAVQAIMGVAHGI
FLSTVVGILNSIVMQVPSTLGRSNTTDANDTGLYSNHLHNASLAWQTGDVLAVSQTISLF
MCLIVFIANIIVLVGLVSNNRRR
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgattgtgactgtcaatcttgatggcaattcgagtttagaaaatatcagtttaggagat
tatcacccaccttctgctggtgatgatgtatcattgtctcaacagacttctgaacgagta
gattgtttcattcatggaggatgtggatctgatgtaatggaacaaccagaagtttttgaa
gctgtgagtatttttgatccgaatgcagagataccaagagctcatgaggtttgcgttacc
tacgttaatgggagtttccaaactttactagaggctcaacacgagtccttgtaccttagt
gaggtccgaggtgagcctgtacgtctgttgtataattctggatggggaggaggggaggga
cgctctcgattattacgaagacctgttgtttcatgttctagtcccctatgtcaagcattg
attgaatccttgaaatactttttctctcatcctgacaaccagcatagacatcatacaatt
atattttacggtgatggtggggctatagttaatgaggtattgcgtcacgtaccttatggt
gatcgggttagggtaattgggatcgcccctaagacatatgttacaggaagtaacgcagcc
cattttagggtgtcaggagatatgactactctgttggactcggcaggatttgcacgtgct
aacgttacaactcttgcttactcttcaggagctgagggattgtttttgccaagtttgcgt
tgtcctagctatgtttgggcgttacgtctagcacaccattcttcttctggtgaatcgagc
tcagaaagtatgttgccgcttgcttccaatcagatttctttggtggaaataggtcatggt
caaggggcctttgagagattatccgagttattgcaattgggagaaacatcttcagaagta
gagtttaatttcactccacaatccaggagtgatattcttttatcgagtatattctgtata
tttagagtttgtggtttactgcaagagtacatcattgtttctgtgacatacgctcctgat
gtttatgtttcgtacgtaatcatttttggctatactttgaatctcttgcgatactttctt
ctattgttgaccaatcgtcgttctgttcgcgatgcgtatagatcattacgtcttattgct
catggattaacacctctgatttttctagtaaccattgtggataatctcaattgtgtaaga
aggtacggcaatccatttccgattttgcaagctatatttgttgtagcatctacattaagt
ggtagtgttatctttatggagttattaagaaattgcttccgaggattgcgaggacgtatc
caaactactattttacaaagattgacaggtgctcctcaggaatcgcaagtcgttgtgcgc
tctgtagatgggaacagaatcggtgctgtgcaggcaatcatgggggtagctcatggaata
tttttatctactgttgttgggatccttaatagtatagttatgcaggtccctagcacatta
ggaagaagtaatacaacagatgcaaatgatacgggattgtattctaatcatttacacaat
gcttctttagcatggcagaccggagatgttctagcagtatcacagacaataagcttattt
atgtgcttgattgtgtttatcgctaatatcattgtcttggtgggtttggtaagcaacaat
cgacgccggtaa

DBGET integrated database retrieval system