KEGG   Chlamydia psittaci CP3: B711_0824Help
Entry
B711_0824         CDS       T02251                                 

Definition
(GenBank) conserved membrane protein
Organism
cpsc  Chlamydia psittaci CP3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_C48
Motif
Other DBs
NCBI-ProteinID: AFS27214
Position
818573..819691
Genome map
AA seq 372 aa AA seqDB search
MANFLLSPPTTYQRSVYTPYNPYSSGERTVGFMRKKTPITGPGSFDNASFLSKFARVILA
SISIIITLGLILCFMSTQNLLDFDIHCSWEDDAEYYYSPYLYDTSVFGSKPRIVFSSWDH
LEISTHLIRLSEQYSNLFVSSLYTPSTCFSIERTVLRDLHMYDSSTQSILDRPDHTQCHH
QGNYQDYPHLMESGCQNFRIYAYPLWHHPSAHNAEEMDSLMLSTAQRGFAGISHWTLVIV
NLDRREVVFFDSLASFIDNRIIDPALNSIATRLGNVHPDANGAFSPFVVRKVIKTPIQQD
SSSCGIWLSLFLDKYLDNPDYEPPVMGYSQAQHVLQEFLETIPQRPITQASDYTRNFLGI
TCDQEENSSSTL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggctaactttcttctttctccgccaactacctatcaaaggtctgtttatacaccgtat
aatccttattcttccggagaaagaacggttggttttatgcgtaaaaaaacgcctattact
ggcccaggctcctttgataacgcttcatttttaagtaaattcgctagagttatactcgct
tccatatctattattatcactctagggttgattctatgttttatgtctacacagaatctc
ttggactttgatatccattgttcttgggaagatgatgcagagtattattactcaccctac
ctgtatgacacgtctgtatttggttcaaaaccgcgtattgtatttagcagctgggatcat
ttagaaatctcaactcatctgatcaggctttctgagcagtattcaaatctattcgtatcc
tctctttatacaccgtcaacctgtttttctatagaacgcacggtgttaagagacctacat
atgtatgactcctctactcaaagtattctagaccgccctgaccatactcagtgtcaccac
caaggcaattaccaagactatcctcatttaatggaaagtggttgtcaaaatttccgaatc
tacgcttacccattatggcaccatcccagcgcgcataatgctgaagaaatggactccctg
atgttatcaacagcacaaagaggttttgcggggatatctcattggacactagttatcgtc
aacttagacagaagagaggttgttttctttgatagtctagcgagctttatagataatcgt
ataattgaccctgcattaaactctatagctactagattaggaaatgtccatcccgatgcc
aatggagcattttctccatttgttgtcagaaaagttataaaaacccctatacaacaagac
agttcgtcttgcggaatttggctttctctattccttgataaatacttagacaatcctgac
tatgagcctcccgtcatgggatactcacaagctcagcatgtcttgcaggaattcttagaa
actattccccaacgcccaataactcaagcttctgattatactcgtaactttctaggaatt
acatgcgaccaagaagaaaactcatccagtacactataa

DBGET integrated database retrieval system