KEGG   Chlamydia psittaci CP3: B711_0830Help
Entry
B711_0830         CDS       T02251                                 

Definition
(GenBank) hypothetical protein
Organism
cpsc  Chlamydia psittaci CP3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COQ7
Motif
Other DBs
NCBI-ProteinID: AFS27220
Position
824727..825386
Genome map
AA seq 219 aa AA seqDB search
MLTSTITTFVSYASRWSSILKNIVADNELHSKWVNTLSFLENCGAKKISISEHPTQVKKE
VLKHAAEEFRHAFYLKTQISRVSDQPFLDYSLDKMLGSYGVKYYLDLLDVRTCKILKNHY
HLSGQTLKTTAYVLVTSAIEMRAAELYPIYYDILKQAGSKVTIKSIILEEQEHLEEMESE
LATLPHAKDLLSYACKIESTLCLQLVTHLEKLIEKTCRV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgcttacgagtacaataacaacctttgtatcatacgcatcacgttggtcatctatcctt
aaaaatatcgttgcggataacgagttacatagcaagtgggtcaatacactatcgttttta
gaaaactgtggggcaaaaaagatctcaattagtgagcaccctacacaagtaaaaaaagaa
gtattaaaacacgctgcagaagaattccgtcatgcgttttatctaaaaacgcaaatctcg
agagtctcagatcaacctttccttgattattctctagacaaaatgctcggttcctatggt
gttaagtattacctagatcttctagatgtgcgcacatgtaaaatactgaaaaaccattac
cacctttctggacaaacattgaagaccacagcctacgtacttgtcacctccgctatagaa
atgcgcgctgctgagctctaccctatctactatgatattttaaaacaggctgggagcaag
gtcactataaaatccattatcttggaagaacaagaacacctagaagaaatggaatcagaa
ttagcaacattaccacacgcaaaagaccttctttcatatgcttgcaaaattgaaagcacg
ctatgcttgcagttagtcactcacttagagaaactcatagagaaaacatgtagagtttag

DBGET integrated database retrieval system