KEGG   Chlamydia psittaci CP3: B711_0831Help
Entry
B711_0831         CDS       T02251                                 

Gene name
aroA
Definition
(GenBank) 3-phosphoshikimate 1-carboxyvinyltransferase domain protein
  KO
K00800  3-phosphoshikimate 1-carboxyvinyltransferase [EC:2.5.1.19]
Organism
cpsc  Chlamydia psittaci CP3
Pathway
cpsc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpsc01100  Metabolic pathways
cpsc01110  Biosynthesis of secondary metabolites
cpsc01130  Biosynthesis of antibiotics
cpsc01230  Biosynthesis of amino acids
Module
cpsc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    B711_0831 (aroA)
Enzymes [BR:cpsc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.19  3-phosphoshikimate 1-carboxyvinyltransferase
     B711_0831 (aroA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase Glyoxalase_4
Motif
Other DBs
NCBI-ProteinID: AFS27221
Position
825443..825790
Genome map
AA seq 115 aa AA seqDB search
MESKNKLAKMLAYKISPSSISGRVSVPPSKSHTLRAIFWASVAQGTSIIHNALASPDSEA
MIQACEQLGAKILRKSTHLGITGTSQLTLPRDTSINAGSSGIVFRFFTALAAIFF
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagcaaaaataagttagccaaaatgcttgcttataagatttctccctcctctata
tctggaagagtttccgttcctccgtcgaagtctcatactctacgagctatcttttgggct
tcggtagcacaagggacttccataatacataatgctctcgcctctccagactcagaagct
atgatccaagcttgcgagcagctaggagcaaaaatccttagaaaatctacacatcttgga
attacgggaacctcccagctaacacttcctagagacacctccatcaatgcaggaagttcg
ggaattgtttttcgtttctttacagcacttgccgcgatttttttctga

DBGET integrated database retrieval system