KEGG   Chlamydia psittaci CP3: B711_0894Help
Entry
B711_0894         CDS       T02251                                 

Definition
(GenBank) rmuC family protein
  KO
K09760  DNA recombination protein RmuC
Organism
cpsc  Chlamydia psittaci CP3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RmuC DUF489 Laminin_II FliD_C
Motif
Other DBs
NCBI-ProteinID: AFS27281
Position
886982..888220
Genome map
AA seq 412 aa AA seqDB search
MIDFSITHLLVACLGLGLGISLSSYYYRKRESSHSEARRNLEHENELLKSSLELSRRQEQ
LMEDFSNKLAVSSQSLIKEMKEETKSYFSEKSKTIESILTPVQATLTAFKQNLETFETKH
AEDRGSLKEQISQLLAAEKKLEKEAQALTDILKHPGSRGRWGEIQLERILELSGMLKYCD
YETQATDNEGSVRADMVIRLPHERCLIIDSKAPFSETYLSGDTSDKSDLVGKIKDHIKTL
KSKSYWQKFHYSPEFVILFLPGESIFNDALRIAPELIDIAATSNVILSGPLTLLALLKTV
AHTWKQENLRAQIQEIGQLGKELHHRLHVVFNYFHKIGKNLNNTVQSYNDMSSSLQHRIL
PTLRKFEDLEITSSLHRVEDPSPIHNPAISFLPGCEEDDIASEDRLFQEDKL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatagacttttcaataacacatcttcttgttgcttgccttggcctcggcttagggatt
tctttatcttcttattattatcgcaagagagaatcttcgcattccgaagcaagaagaaat
ttggagcatgaaaatgaactccttaaaagttctttagagttatcacgtcgtcaagaacaa
ctgatggaggatttcagcaataaacttgctgtttcttcacaatctcttattaaagagatg
aaagaagaaacaaagagctacttctctgaaaaatctaaaactattgaatctatattaact
cctgttcaggctacgctgactgcttttaagcaaaacttagaaactttcgagactaagcat
gctgaagatcgtggttccttaaaagaacaaatttcccagcttcttgctgcggaaaaaaaa
cttgaaaaagaagctcaagctttgacggatatcttaaaacatccaggatcacgaggccgt
tggggagagattcagttagaaagaatcttagagctttcaggtatgcttaaatattgcgat
tatgaaacacaagctaccgataatgaaggttcagtacgagctgatatggtcatccgtctc
ccccacgaacgctgtttgatcatcgattccaaggctccattttcagaaacatatttgtct
ggggatacttctgataaatctgacttggtagggaaaatcaaggatcatatcaaaacacta
aaatcaaaaagctactggcaaaaatttcattactccccagaatttgtcattcttttcctt
cctggcgagagtatttttaatgatgctctacgtattgctcctgaacttatcgatatcgca
gcaacttctaatgtcattctatcgggacctttaacactactcgctttattaaaaactgtt
gctcatacatggaaacaggaaaacttaagagcacagatccaggaaataggacaattagga
aaagagttacaccatcgtttacatgtggtctttaactattttcacaagattgggaaaaat
cttaacaatactgtgcaaagctataatgatatgtcgtctagcttgcagcataggatatta
ccaacactacggaaattcgaagatttagagataacatcttctctacacagagtagaggat
ccatctcctatccataatcccgcaatatcttttcttccaggctgcgaagaagatgacatc
gcttcagaagatcgcttattccaagaagataagctgtaa

DBGET integrated database retrieval system