KEGG   Chlamydia psittaci CP3: B711_0898Help
Entry
B711_0898         CDS       T02251                                 

Gene name
sucD
Definition
(GenBank) succinate-CoA ligase, alpha subunit
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
cpsc  Chlamydia psittaci CP3
Pathway
cpsc00020  Citrate cycle (TCA cycle)
cpsc00640  Propanoate metabolism
cpsc01100  Metabolic pathways
cpsc01110  Biosynthesis of secondary metabolites
cpsc01120  Microbial metabolism in diverse environments
cpsc01130  Biosynthesis of antibiotics
cpsc01200  Carbon metabolism
Module
cpsc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B711_0898 (sucD)
   00640 Propanoate metabolism
    B711_0898 (sucD)
   00660 C5-Branched dibasic acid metabolism
    B711_0898 (sucD)
Enzymes [BR:cpsc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     B711_0898 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AFS27285
Position
complement(894522..895397)
Genome map
AA seq 291 aa AA seqDB search
MFFSLSKNSPIITQGITGKAGSFHTEQCLAYGSNFVGGVTPGKGGTKHLNLPVYDSVLEA
KQATNCRATMIFVPPAYAAEAIIEAEDAGIELIVCITEGIPVKDMLEVSHVMQYSSSRLI
GPNCPGIIKPGVCKIGIMPGYIHLPGSVGVVSRSGTLTYEAVWQLTQRSIGQSLCIGIGG
DPLNGTSFIDVLEEFQNDPQTELILMIGEIGGSAEEEAAEWIQAYCTKPVIAFIAGETAP
KGKRMGHAGAIISGNSGDAKSKKEALRRAGVCVVESPALIGETVETLLRSL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtttttctcattaagtaaaaactccccgattatcactcaaggaatcacaggaaaagcc
ggctcgtttcatacagagcaatgccttgcatatggatcaaatttcgtaggaggagtcact
cctgggaaaggagggacaaaacatctaaatcttcctgtatatgattctgtattagaagca
aaacaagcaacgaattgtcgcgcaacaatgatatttgtccctcctgcttatgctgcagaa
gcgataattgaagctgaggatgcaggaattgagctgattgtttgcattacagaaggtatc
cctgtcaaagatatgctcgaagtgagccatgtgatgcaatatagctcttcccgattgata
ggtcctaattgcccaggaattataaagcccggtgtatgtaaaattggtatcatgccagga
tatatccaccttcccgggagtgtaggtgtcgtttcaagatcaggaacattaacttatgaa
gctgtttggcaactcactcaacgaagtataggacaaagcttatgcataggtataggtgga
gaccctttaaacgggacttcgtttattgatgttctagaagaatttcaaaatgatcctcaa
acagaactcatattgatgattggagaaataggaggtagcgctgaagaagaagctgccgaa
tggatccaagcttactgtaccaaacctgttatcgcgtttattgctggggaaaccgctcct
aaaggaaagcgtatgggtcacgctggagctattatttctggaaattctggagatgctaaa
agtaaaaaagaagctttgagaagagctggagtctgtgttgttgaatctccagctttaatt
ggagaaactgtagaaaccttattacgctctctataa

DBGET integrated database retrieval system