KEGG   Chlamydia psittaci CP3: B711_0900Help
Entry
B711_0900         CDS       T02251                                 

Gene name
ftsY
Definition
(GenBank) signal recognition particle-docking protein FtsY
  KO
K03110  fused signal recognition particle receptor
Organism
cpsc  Chlamydia psittaci CP3
Pathway
cpsc02024  Quorum sensing
cpsc03060  Protein export
cpsc03070  Bacterial secretion system
Module
cpsc_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    B711_0900 (ftsY)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    B711_0900 (ftsY)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    B711_0900 (ftsY)
Secretion system [BR:cpsc02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   B711_0900 (ftsY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SRP54 CbiA ArgK AAA_31 Zeta_toxin SRP54_N AAA_30 cobW AAA_16 AAA_14 ATP_bind_1 ABC_tran AAA_24 AAA_33 KAP_NTPase Thymidylate_kin AAA_29 AAA_19 G-alpha AAA_22 AAA_28
Motif
Other DBs
NCBI-ProteinID: AFS27287
Position
896643..897497
Genome map
AA seq 284 aa AA seqDB search
MFKFFSSKIQSLFKKTLSPDLLEFTESLFYEADFGSDLTEELCSRLRKCRKPDVSTVKDL
VSSLLRETLDSLPRVESCQGQAPMVSLILGINGSGKTTTVAKLAHYHMSRSEKVMIVATD
TFRSAGMDQMRCWADKLGCGFVSGKPGGDPAAIAYDGIASAMSRGYDRVLIDTSGRLHTH
TNLLNELSKIVSVCNKIHPGSPHERLMTIDATLGGNVIEQVRVFHEVIPLSGLILTKVDG
SAKGGTLFRVAKQLKIPTKFVGYGELIGDLEEFHIDRFLAKLFP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaagttctttagtagcaagattcagtctctatttaaaaaaactctctcccccgat
cttttagaatttacagaaagtttgttttatgaagcagattttggatcagatcttactgaa
gagttgtgctctcgtttgcgcaaatgccgtaaaccggatgtgtctactgttaaagatcta
gtttcctcattacttcgtgaaactctagacagcttacctcgtgtagaatcttgtcaagga
caagcccctatggtttctttgatattgggaataaatggttcggggaaaaccacaactgtg
gctaaacttgcccactaccacatgtctcgatcggagaaagttatgattgttgccacggat
actttccgtagtgctggcatggatcagatgcgttgttgggcagacaaattaggttgtgga
ttcgtatcagggaagcctggcggcgatcctgctgctattgcttatgacggcattgcttct
gctatgtctcgaggttacgaccgtgtacttattgatacttcaggtcgtttgcacacgcat
accaacttactcaatgaattatcaaaaattgtttcagtatgtaataaaatacacccaggg
tctccgcacgaacgactcatgactatagatgcgactttgggaggaaatgttattgagcag
gtacgagttttccatgaagtcattcctctatccggactcatcctaactaaagttgatggt
tctgctaaaggcgggacattatttcgtgtggcaaaacaattaaagatccctacaaaattc
gtcggctacggcgaacttataggggaccttgaagaatttcatatagataggttcttagca
aagcttttcccttaa

DBGET integrated database retrieval system