KEGG   Chlamydia psittaci CP3: B711_0904Help
Entry
B711_0904         CDS       T02251                                 

Gene name
glmM
Definition
(GenBank) phosphoglucosamine mutase
  KO
K03431  phosphoglucosamine mutase [EC:5.4.2.10]
Organism
cpsc  Chlamydia psittaci CP3
Pathway
cpsc00520  Amino sugar and nucleotide sugar metabolism
cpsc01100  Metabolic pathways
cpsc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpsc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    B711_0904 (glmM)
Enzymes [BR:cpsc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.10  phosphoglucosamine mutase
     B711_0904 (glmM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFS27291
Position
complement(901373..902749)
Genome map
AA seq 458 aa AA seqDB search
MTKEVKQLFGTDGVRGKANYEPMTVELSVLLGKAVAGVLQESKSGKHRVVVGKDTRLSGY
MFENALVAGLTSMGIETLVLGPIPTPGVAFITRAYRADAGIMISASHNPYWDNGIKIFSS
EGFKISDVVERRIEQMVALREFGNLPDDCAVGKNKRVVDAMGRYIEFAKATFPRGRTLKG
LKIVLDCAHGAAYKVAPSVFEELDAEVICYGCEPTGSNINDDCGALFPSVIQKAVIEHKA
DVGIALDGDGDRVIMVDEKGHIVDGDMILSICANDLKKKDLLRGNRVIATVMTNFGVLKY
LESVGIEALISPVGDRHVLQNMLEYDVNLGGEQSGHMIFLDYNTTGDGIVSALQVLRIMI
ESESTLSDLTSLIVKSPQALVNVAVKEKIPLDTLPLVQEALRDVRSSLGDSGRVLLRYSG
TENICRVMVEGLKKHQVDSLAKTIADIVDSELGVGVVE
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggaagtaaagcaactttttggcacggatggggtgcgtgggaaagcaaattat
gaacctatgactgtagagctttcggtattattaggaaaagctgttgcaggtgttctacaa
gaaagtaaatccgggaaacaccgtgttgtcgtaggtaaggatacacgtttatcgggatat
atgtttgagaatgccctggttgcgggtttgacttctatggggatagaaaccttagtattg
gggcccattcctactccaggagtagcgtttattacccgtgcttaccgtgccgatgccggt
attatgatttccgcatctcataatccttattgggataatgggattaagattttctcgtct
gaaggatttaaaattagtgatgtcgtagaacgacgtattgagcaaatggtcgctcttaga
gagtttggaaatctccctgatgattgtgctgtagggaagaacaaacgtgtcgtggatgct
atggggaggtacatagagtttgctaaagctactttccccagaggaagaacactaaaaggg
ttgaagatagttttagattgtgcccacggggcagcctataaagtagctccttctgttttt
gaagaacttgatgctgaagtgatttgttatggttgtgaacctacaggaagtaatattaat
gatgactgtggggctcttttcccttccgtgattcaaaaagctgtgattgagcataaggca
gatgtaggtattgccttagatggtgacggtgatcgcgtgatcatggtggatgagaaaggg
catattgttgatggagatatgattttaagtatctgcgctaatgatctaaagaaaaaggat
ctcttacgaggtaatcgtgttatagctaccgttatgaccaatttcggtgtattgaaatat
cttgaaagtgtaggaatagaagcattaatttctcccgtgggcgatcgccatgtcttacag
aatatgttagagtatgatgtcaaccttggtggtgagcaaagtggccatatgatctttctg
gattataatactacaggagatggtattgtttctgctttgcaggttttgcggattatgatt
gaaagcgaatctacgttatcagatttaacatccctgattgtaaaaagtcctcaagcactt
gtcaatgttgcagtgaaagaaaaaatccccttagataccttgcctttagttcaagaagca
cttagagatgttagatcatctttaggtgattctggtcgcgttttattaagatattctgga
acggaaaatatttgtagggttatggttgagggtttaaagaagcatcaagtagactctctc
gctaagactatagcggacatcgttgattctgagttgggagtaggcgtggtagagtaa

DBGET integrated database retrieval system