KEGG   Chlamydia psittaci CP3: B711_0963Help
Entry
B711_0963         CDS       T02251                                 

Definition
inositol monophosphatase family protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cpsc  Chlamydia psittaci CP3
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cpsc00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
969170..970150
Genome map
AA seq 326 aa AA seqDB search
MPSHLLDYQRVAESIVEKTIAELIHYRQRLPLVPFWTKPDGSSVTPADYAVQYCLQKKLS
TTFPHIPFIGEEVLDPVSDKHKINSILEFIHRLDSQVTPEDLLETLSPNQEASTLYWLVD
PIDGTSGFIKNRFFASAVSLIYEDKPILAVMACPCTDRHTFKIYSAAKNYGVSLFGTAIE
TRHYLKSGETLTGKFCEASLAARNQQHHATRLLSLSLPGQPQACRVDSQYKYAMVAEGAV
DFFIRYPFAISQARAWDHAPGAFLVEESGGVVSDIFGNSLNYRREDFILENHPIILASGN
AEIHRITLDALQEQANIVSEENLLAY
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctcatttactagactatcaaagagttgcagaaagtatagttgagaaaaccatc
gccgagttaatccattatcgacaacgccttcctctagtccctttctggacaaaacccgac
gggtcttctgtcacacccgcagattatgctgtccaatactgccttcaaaaaaagctatca
acaacttttccacatattccgtttatcggggaagaagtcttagaccctgtaagcgataaa
cataaaattaatagtattttagaattcattcacagactagattcgcaggtgacacctgag
gatcttttagaaacattaagccccaatcaagaagcctcgactttatactggcttgttgat
cctattgatggtacgtcaggatttattaaaaaccgtttttttgcctctgcagtatcctta
atttatgaggataagcctatactcgcggttatggcgtgcccatgcacagaccgccatact
tttaaaatctattctgctgctaaaaactatggggtttctttatttggtacggcaattgaa
actcggcattatttaaaatctggagaaacgctaacggggaagttttgtgaagcatctcta
gctgcacgtaaccaacagcaccacgctacacgcttattaagtctctccttgccagggcaa
ccccaagcttgtcgagttgacagtcaatacaaatatgctatggttgctgaaggcgctgta
gacttttttatccgctacccctttgctatttctcaagcaagagcgtgggatcatgctcca
ggggcttttttagtagaagagtctgggggcgtagtttccgatatttttggaaattcgctc
aactatcgtcgagaagatttcattttagaaaaccatcccataattctagcttccgggaat
gcggaaattcacagaattacgttagacgccttacaagaacaagcaaacattgtttctgaa
gaaaacttgctagcttactaa

DBGET integrated database retrieval system