KEGG   Chlamydia psittaci CP3: B711_1140Help
Entry
B711_1140         CDS       T02251                                 

Definition
dihydrofolate reductase family protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cpsc  Chlamydia psittaci CP3
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cpsc00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cpsc00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1153419..1153862)
Genome map
AA seq 147 aa AA seqDB search
MGKQGKLPWNYPEDIEFFSKTIGNHVLIMGRKTFEGLPDKYKKNRKIIVFSRDYHESFEN
VIWVSSLEEFRRLEQLSSIFLIGGGELFSLFLENRMVDGCFITHIHKCYEGDVFFPLSLI
KGWRKTVLDEKENLTFCFYENFADCHS
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagcaaggaaagcttccgtggaactatcctgaagatatcgaatttttttccaaa
actataggaaatcatgtcctaatcatggggagaaagacttttgagggtcttcctgataag
tataagaagaaccggaagattattgtcttttccagggattatcatgaaagtttcgagaat
gtaatctgggtatcttctttagaggaatttagacgtttagaacaactttcttctattttt
cttattggcggaggagaattgttttctttatttttagaaaatcggatggtggatgggtgt
ttcataactcatattcacaagtgttatgagggtgatgttttcttccctctatctttaatc
aaagggtggaggaaaactgttttagatgagaaagagaacttaacattttgtttttatgaa
aatttcgccgattgtcactcgtag

DBGET integrated database retrieval system