KEGG   Chlamydia psittaci 01DC12: BN356_1261Help
Entry
BN356_1261        CDS       T02343                                 

Gene name
ruvA
Definition
putative holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cpsd  Chlamydia psittaci 01DC12
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpsd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BN356_1261 (ruvA)
Enzymes [BR:cpsd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BN356_1261 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
124592..125260
Genome map
AA seq 222 aa AA seqDB search
MPRAYFCVYLFGSSVMYDYIRGVLTYISSGTMVIESQGLGFSIFAPDRWLMELSSQLHRE
LIVYTYTVVRETEHVLYGFNTRGERECFRMLISFSGVGPKTGLAILNTFSLSKLCSIARA
EDIKAIASVPGIGKKTAEKLMVDLKQKLADLLPLDSQITASWGPAKPSCMEEGIQALAAL
GYPKSSAERMIAEAMSELPDHASIAEILPIALKKNLQGLNKS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccacgcgcatacttctgcgtatacttgtttgggagttcggtgatgtacgactatatt
cgtggtgtgcttacttatatcagttcaggaactatggtaattgaaagtcagggactgggg
tttagtatttttgctcctgatagatggcttatggaattgtcaagtcaactacaccgcgag
cttatagtctatacttatactgttgttcgtgaaactgagcatgttctctatggatttaat
actcgtggagaacgcgagtgtttccgtatgttaatttcattttcaggagtgggacctaag
acaggtttagcgattttaaatacattttctcttagcaaattgtgttctatagctcgtgct
gaggatatcaaagctatagcttctgttccgggtatagggaagaaaacagctgagaaactt
atggtggatttgaagcaaaagcttgcagacttactccctttagattcgcaaatcaccgct
tcttggggaccagcaaaaccttcttgtatggaagagggaatacaagctttagcagcatta
ggctatccaaaatcctcagcagagagaatgatcgccgaagctatgagcgagctcccggat
catgcgtcaatagcagaaattcttcctattgctctaaagaagaatttacaaggtttgaac
aagagctag

DBGET integrated database retrieval system