KEGG   Chlamydia psittaci 01DC12: BN356_1791Help
Entry
BN356_1791        CDS       T02343                                 

Definition
putative peptidoglycan synthesis protein
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cpsd  Chlamydia psittaci 01DC12
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpsd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BN356_1791
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BN356_1791
Enzymes [BR:cpsd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BN356_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
179580..180914
Genome map
AA seq 444 aa AA seqDB search
MAAAEVFGGCVLEGSVRVSGAKNSTTKLLVASLLSDRKCILRNVPDIGDVRLTVELCRSL
GSIIHWDKQAEVIEIHTPEIRMSEVSAQFSRVNRIPILLLGALLARCPEGVIVPCVGGDA
IGERTLNFHFEGLERLGAKVVYDGHGYQAAAPQGLVGAYITLPYPSVGATENLILASVRA
QGRTIIKNAALEVEILDLILFLQKAGVEITTDNDKTIEIFGCDDFYEVDHWVIPDKIEAA
SFGMAAVLTGGRIFVENAEQYLMIPFLKTLRSIGGGFSVTETGIEFFYNEPLKGGVVLET
DVHPGFLTDWQQPFSVLLSQAEGSSVIHETVHENRLGYLRGLQQMGANCELFYQCLSSKA
CRYATGNFPHSAVIHGATPLKASELVIPDLRAGFAYIMAALIAEGGPSLIRNTQLLDRGY
YNWVDKLNSLGAKIHLLSLDPVAF
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagctgaagtttttggtggttgtgtgttagaaggttctgtgcgggtatctggg
gccaaaaactcgacaaccaagttactcgttgcgtcattattatcggatcgcaaatgcatt
ttacgtaatgtccctgatataggagatgtacgtttaactgttgaattgtgccgttcttta
ggttctataatacattgggataaacaagcagaagtcatagagattcatacacctgagatt
cgcatgtccgaagtgtccgcacagttttctcgggtgaatcgtattcctattttattatta
ggagctctactagctcgctgtccggaaggcgttattgtcccctgtgttgggggagatgct
ataggggaaaggactctaaattttcattttgagggtttagaacggctaggggcaaaggtt
gtctatgacggacatggatatcaagctgctgctcctcaaggtcttgtcggagcgtacatt
actcttccttacccttctgtaggagctactgagaatttgatattagcttctgttcgcgct
cagggaagaacgatcatcaagaacgctgctttagaagtagaaatcttggatcttattttg
tttttgcaaaaagcaggagtggagatcactacagataatgataagacgatagaaattttt
ggttgtgatgatttttacgaagtagatcactgggtgatccccgataagatagaagcggct
tcatttggtatggctgccgtgcttaccggcgggcgcatttttgtagaaaatgccgagcaa
tatctgatgattccttttcttaaaaccttaaggtctataggaggagggttctcagtgaca
gaaacaggaatcgaattcttttataacgaaccattaaaaggtggtgttgtattagaaacc
gatgtacatcctggattccttacagattggcaacaacctttttcagttcttctctctcag
gcagaaggatcttctgtgattcatgaaaccgtgcatgagaatcggctagggtatttacgc
ggtttacagcaaatgggagcgaattgcgagctgttctaccagtgtttaagctcaaaggct
tgtcgttatgcaaccggaaattttccccatagtgctgtcattcacggagcgacaccattg
aaagcttctgaactggttattcccgatttgcgtgcaggatttgcctatattatggcagct
ctcattgcagagggtggaccttctttaatcagaaatacccagttgttagatcggggatat
tacaattgggtggacaaactgaactctttaggagcaaagatccacttgttgtccttagat
cccgtagcgttctaa

DBGET integrated database retrieval system