KEGG   Chlamydia psittaci 01DC12: BN356_2261Help
Entry
BN356_2261        CDS       T02343                                 

Definition
(RefSeq) putative lipoyl transferase protein
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpsd  Chlamydia psittaci 01DC12
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpsd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN356_2261
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN356_2261
  Amino acid metabolism
   00310 Lysine degradation
    BN356_2261
Enzymes [BR:cpsd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BN356_2261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
234799..235968
Genome map
AA seq 389 aa AA seqDB search
MFEFRFPKIGETGSGGLVVRWLKQVGENVAKDEPVIEVSTDKIATELASPKAGKLIRCLV
KEGDEVAAEEVIALIDTESAVEEEVVVEELSPNASCPQDSGKNSAWFSPAVLSLAHREGV
SLQQLQQISGTGNDGRVTRRDLENYILEMRQPSCPNIANANENRIPMSPLRRAIASSLSK
SSDEVPHASLIVDIDVTDLMNLIAEEKDRFFATHGVKLTITSFIIQCLAKALEQFPLLNG
SLDGDTIVVKKSINVGVAVNLNKEGVVVPVIHNCQDRGLVSIAKTLADLSARARANKLDP
SETQDGSVTVTNFGMTGALIGMPIIRYPEVAILGIGTIQKRVVVRDDDSLAIRKMVYVTL
TFDHRVLDGIYGSEFLTSLKNRLESVTMS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatttcgatttccgaaaataggagagactggttctggagggttggtagttcgt
tggctcaagcaggtgggagagaacgttgcaaaagatgagcctgtaattgaagtatctact
gacaagattgctacggagttagcctctcctaaagcagggaaattaattcgctgtctcgta
aaagaaggtgatgaagttgctgccgaagaagtgatagccttaatagatacggagtctgct
gtcgaggaagaggtcgttgtcgaagaactgtcacccaatgcttcgtgtcctcaagattct
gggaagaattcggcatggttttctccggcagttcttagtttggcacaccgtgaaggtgtt
tctctccagcaactacaacagatttctggaacaggaaatgatgggcgcgtcactcgtagg
gatttagaaaactatatccttgaaatgcgccaaccttcgtgcccaaatattgcgaatgcg
aatgaaaatcgcattcccatgtctccactacgtagagctatagcttcctcgttatctaaa
tcttcagatgaagtgcctcatgcttctcttattgtggatattgatgtcacagatttgatg
aatttaattgctgaagagaaggatagattttttgcaacgcatggtgtgaaactcacaatt
actagtttcattatccagtgtttagccaaggctttggagcagttcccgttattgaatgga
tctttagacggcgatacaattgttgtgaagaaatcaatcaatgtgggtgttgctgttaat
ttgaataaagagggcgttgttgttcctgttattcataattgtcaggatcgtggtttagta
agcattgcgaaaactctcgctgatctttctgcaagagctcgggcaaataaacttgatcct
tcagaaactcaagacggtagtgtcaccgttactaatttcggtatgacgggagctttaatt
ggcatgccaataattcgttatccggaagtagctattttaggaataggaacgatacaaaaa
cgtgttgttgtgcgtgatgacgattctttagctattcgcaaaatggtctatgttaccctc
acgtttgaccacagggtattggatggtatttacggtagtgaatttttaacctcattgaaa
aatcggttagagtctgttacgatgagctaa

DBGET integrated database retrieval system