KEGG   Chlamydia psittaci 01DC12: BN356_2311Help
Entry
BN356_2311        CDS       T02343                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cpsd  Chlamydia psittaci 01DC12
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpsd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN356_2311
Enzymes [BR:cpsd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BN356_2311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(240185..240850)
Genome map
AA seq 221 aa AA seqDB search
MTIYLGLNRETANRYHASFVPILEIIPFARSSPQLRYALRYLEETSHILLTSPSSTSLFI
SRMRRKNSKKTLSTKHYLCLGEITASRLTRLLPKAQYSPATIETGEGVLPMISSLPKNAR
ILYPHSALSRSVIEDFLKRENRSFFAYSHYTIRERQLHPSVFKQCSRVILTSPSGVRAYA
KLFPQLPRRIHICQGPITLKEFREIYNHPGELLQKDSLTES
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaccatatacctaggattaaatcgagaaacagcaaacagataccacgccagcttcgtt
ccgattcttgagatcattccctttgcaagaagctctcctcaactacgttacgccctgcgt
tacctagaagaaacttctcatatcctgctcaccagcccatcttcaacatcactatttatt
tctagaatgcgcagaaaaaattctaaaaagacgttatctaccaaacattacctttgttta
ggagaaatcacagcaagtcgccttacaaggcttctcccaaaagcacaatattccccagct
actattgaaaccggagaaggcgtgctcccaatgatctcctctttacccaaaaacgctcgt
atcctctacccacactcagccttatcgcgttctgtaattgaagattttttaaaaagagaa
aaccgaagcttttttgcctattcccactacaccattcgagaacgtcaattacacccctct
gtattcaagcagtgcagccgtgtaattttaaccagtccctctggagttagggcgtatgct
aaactcttcccccagctcccaaggagaatacacatctgccaaggcccgatcacacttaaa
gaatttagggaaatttacaaccatcctggggaacttcttcaaaaggacagccttaccgaa
agctga

DBGET integrated database retrieval system