KEGG   Chlamydia psittaci 01DC12: BN356_4171Help
Entry
BN356_4171        CDS       T02343                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpsd  Chlamydia psittaci 01DC12
Pathway
cpsd00020  Citrate cycle (TCA cycle)
cpsd00310  Lysine degradation
cpsd01100  Metabolic pathways
cpsd01110  Biosynthesis of secondary metabolites
cpsd01120  Microbial metabolism in diverse environments
cpsd01130  Biosynthesis of antibiotics
cpsd01200  Carbon metabolism
Module
cpsd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpsd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN356_4171 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BN356_4171 (sucB)
Enzymes [BR:cpsd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BN356_4171 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: CCO01929
Position
472952..474049
Genome map
AA seq 365 aa AA seqDB search
MITEVRIPNVAESISEVTIASLLVTSESLVQENQGIMEIESDKVNQLIYAPISGRIVWSV
AEGDVVAVGGIVAKIYDANESVSESTAKETPVEETVDAEIINFPRSTAHNPPSEGKTFVP
LREKMQEEPQRSGAKNEVRERMSSIRKTISRRLVTALHESAMLTTFNEIHMTPLMQLRKE
KQEAFSSRYNVKLGLMSFFIKAVIEALKAYPRVNAYIDGDEIVYRQYYDISIAVGTERGL
VVPVIRECDKLSSGDIEVKLADLASRARDGLISLPELEGGSFTITNGGVYGSLLSTPIIN
PTQVGILGMHKIEKRPVVIDNTIAIADMMYVAFSYDHRIIDGKEAVGFLIKIKDAIEQPE
GLLDF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgattacagaagtacgcattccaaatgtcgctgaatccataagcgaagtcaccatagct
tctcttttggtgacttcagagagtctggttcaggagaatcaaggcattatggagatcgaa
agcgataaggtaaatcaacttatctatgctcctatatcgggaaggatcgtttggtctgtc
gctgaaggagacgttgttgccgtcggtggaatcgttgctaagatctatgatgctaatgaa
tctgtttccgaaagtacagcgaaggaaactccggtagaggagacagtagatgcggagatt
attaatttcccgaggtctacagctcacaatcctccttctgagggaaaaacatttgttcct
ttacgtgagaaaatgcaagaagaaccgcaacgttcgggagctaaaaatgaggttcgtgag
cgtatgtcatccatacgcaaaacgatttctcgacgtttagttacagctcttcatgaatca
gcaatgttaacaacattcaatgagattcatatgacccctctgatgcaacttcggaaggaa
aaacaagaggccttttcttctcgctataatgtgaaactcggtttgatgtcctttttcata
aaagcagttattgaagctctgaaggcttatcctcgtgtaaatgcgtatattgatggcgat
gagattgtctatcgtcagtattacgatatttccattgctgtaggaacagaacgcggtctt
gttgtccctgtgattcgtgagtgcgataaactctctagtggcgatatcgaagtgaaactt
gcagatttggcaagtagagctcgagatggtttaatttctcttccagagttagaaggagga
agtttcactattaccaatggtggggtgtatggttccttactttctacgccgattatcaat
cctactcaagtggggatattgggaatgcacaaaatagaaaaacgccctgtagtgatcgat
aatacaatcgccattgcggatatgatgtatgttgcctttagctacgaccatcgtatcatc
gatggtaaagaggcggttggtttccttatcaaaatcaaagatgctatagaacaaccagaa
gggttacttgatttttaa

DBGET integrated database retrieval system