KEGG   Chlamydia psittaci 01DC12: BN356_4521Help
Entry
BN356_4521        CDS       T02343                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cpsd  Chlamydia psittaci 01DC12
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cpsd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(513531..515123)
Genome map
AA seq 530 aa AA seqDB search
MTPFSKALRYIQDSPAKHNWKPLGTMPKHGICVPLFSLHTKNSCGIGEFLDLLPLISWCQ
KHKLQIIQILPINDSGEDSSPYNSISSVALNPLYLSLASLPHVQSIPHAQSKLKTMQALS
QLPYVHYPQVKVAKWEFLQDYYQYVVKIGALKDEEFLIFCEKEKYWLRPYTVFRSIKSYL
KGAPINNWAKAYTDRTNFSKFEKQFQKESEFFSYLQFLCFQQMSQVKSYADDHQILLKGD
LPILISKDSCDVWYYRQFFSSSGSAGAPPDIYNIEGQNWHLPVYHMHNLAQDNYTWWKAR
LRYAENFYSLYRLDHIVGFFRLWVWDSSGNGKFQPEDASEYLRQGTDILKHILRASRMLP
IGEDLGSVPSDIKHTLLKLGICGTRIPRWERNWEGDGSFIPLDQYSPLSVTSLSTHDSDT
LALWWRHAPKEARKFAKFLGIPFTPVLSEEDQKHILKVSHKTSSIFHINLINDYLALCPD
LVSDNLKYERINIPGTVSKNNWVYRIKPSMEEIVTHDAFNAHLSEIFADL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgacgccattttctaaagctttacgctatattcaagactctccagctaagcacaactgg
aaacctttaggcaccatgcccaagcatggaatttgtgttccgttattttctctacatacc
aaaaatagctgtggcattggcgaattcttagatctccttcctctgatttcttggtgccaa
aaacataagttacagatcatacagattcttcctattaacgatagcggtgaagatagtagc
ccttacaacagcatatcttcagtcgctctcaatcccctttatctttccttagcaagcctt
ccccacgttcagtctattccccatgctcagtctaagttaaagacaatgcaagcactatct
caacttccttatgtgcactacccacaagtcaaagttgcaaaatgggaatttcttcaagac
tactatcaatacgtagtaaaaatcggtgctttaaaagatgaagaatttctgatcttttgt
gaaaaagaaaaatattggctacgtccctatacagtattccgttctataaaatcctatctc
aaaggagctccaataaataactgggcaaaagcctatacggataggacaaacttctcaaaa
tttgagaaacaattccaaaaagaatccgagtttttctcctatctccaattcctgtgcttt
cagcaaatgtctcaagtaaaatcctatgctgatgatcatcagattctacttaaaggcgat
cttcctattctcattagtaaggatagttgtgacgtttggtactatagacaattcttttcc
tcatcaggatcggcaggcgctcctcccgatatttacaatattgaagggcagaattggcac
cttcccgtttatcatatgcacaatttagcccaagataattacacctggtggaaagcacgt
ctccgctacgctgagaatttctactctctatacaggcttgatcatatcgtaggattcttt
cgtctatgggtgtgggactcttcaggaaatggaaagtttcaaccagaagatgcgagtgaa
tatcttcgccaaggcacagacatactgaagcacatactacgcgcatcccgcatgctccct
ataggagaagatttaggaagcgtgccttctgatataaaacacaccttgttaaaactaggc
atatgcggcacacgcattcctcggtgggaacgcaattgggaaggtgatgggagtttcatt
cccttagatcaatactcccctctatcagtgacttcattatccacacatgattcggataca
cttgctctttggtggcgacatgccccgaaagaagctcgaaaatttgcaaaatttttagga
ataccttttactcctgtcctctctgaggaagatcaaaaacatatcctaaaagtttctcac
aaaacatcatctatttttcatattaacttaattaacgactacctcgcactttgccctgat
ttagtatctgacaatctaaaatacgaacgcataaatataccgggaacagtatcaaaaaat
aattgggtatatagaatcaagccttccatggaagaaatagtcactcatgatgcgttcaat
gcgcatctctccgaaatatttgctgatctttaa

DBGET integrated database retrieval system