KEGG   Chlamydia psittaci 01DC12: BN356_6371Help
Entry
BN356_6371        CDS       T02343                                 

Definition
putative exodeoxyribonuclease
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpsd  Chlamydia psittaci 01DC12
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpsd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BN356_6371
Enzymes [BR:cpsd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BN356_6371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
739870..742074
Genome map
AA seq 734 aa AA seqDB search
MEKISGKLESVLFEDHDSKETAARMRIPYKGTMIVIKGQFPDSFLQLGMQLHVYGKWSEN
PNLGKYFQVYSCDSQEMRDNRGIINYLTSKLIKGIGPKITEKIIEKFRNDTADILDNQPE
RLIEIPGISQTRCDSLCEQLREQKNLRTTLLFLQQYNIAIHYGVKIYKKYKENSIEKICE
DPFLLAREMEGIGFKTADLIATRLGVPLNSQSRLCAGIQYSLEELQEDGHTCYPLQSLAQ
LVEKLLNQDIPEKLIRIEEIISQVYIMQEKNLLHIEELENTPYVWVKHIYLAEKTVVSDL
KRILFSSRKIRPIDSDKAIQWVEENLSIHLEQNQKEAIRACFSEKIHIITGGPGTGKSTI
TKAILKIFEQVTYKIILAAPTGKAAKRMTEITGKHSVTIHALLQYDFKTRSFRKNYENPI
DCDLIIVDESGMMDTYLLYHFLKALPDHVIVIFIGDVHQLPSIGPGNILKDIINSKKITV
TKLNKIFRQVHDSNIIINAHKVNEGEFPVLYSESGRKDFLFFQKEDPQEAVDHIVHLVTQ
FIPKKYHIYPKDIQILAPMKKGVLGIHNLNRVLKSALNPKQATLHGRFHSYAVGDKVMQI
RNNYNKEIFNGDIGYISMINFENKRVVVNMEGKYVVYSFSELDDLVLAYATSVHKYQGSE
SPCIILPIHTSHFMMLYRNLLYTAITRGKQLVVLVGTKKAIAIATRNDKVQHRCTGLLQA
LEQLTQPQYQTHYH
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatttccggaaaattagaaagcgtgctttttgaagatcatgattcaaaggaa
actgctgcacgcatgagaataccctataagggtaccatgatcgttatcaaaggacaattc
cccgattcttttttacagctcggtatgcaactacatgtatacggaaagtggtcagaaaat
cccaacctagggaagtacttccaagtctatagttgtgattctcaagaaatgcgggataat
cgcgggataatcaactaccttacctctaaacttatcaaaggcattgggccaaaaatcaca
gaaaaaatcatcgagaaattccgaaatgacaccgcagatatcctcgataatcaacccgaa
agattaatagaaatccccgggattagccaaacacgctgtgatagtctctgtgaacaactc
cgcgagcaaaaaaatcttaggactactctactcttcctacaacagtacaacattgcgatt
cattacggtgtaaaaatctataagaagtataaagagaactctatagaaaaaatatgtgaa
gatccttttcttcttgctagagaaatggagggcatcggatttaaaactgctgatcttata
gcaacacgtcttggcgtgcctttaaactcacaaagccgattatgtgccggaatacaatat
tccctagaagaactccaagaagacggtcatacttgctaccccttacaaagtctggcgcag
ttagtagagaaactactcaatcaagatattccagaaaaactcatacgcattgaagaaatc
atttctcaagtgtacatcatgcaagagaaaaatcttcttcatatcgaagagttagaaaac
accccctacgtgtgggtaaaacatatttacctagcagaaaaaacagtagtttctgattta
aaacgtattttattttcctcaaggaaaatccgccctatagatagcgataaagccattcaa
tgggttgaggaaaacttaagtatacatttagagcaaaaccagaaagaagctattcgtgcg
tgtttttcagaaaaaattcatattattactggaggaccaggaacagggaaaagtaccatc
actaaggctatactcaagatatttgagcaagtgacttataaaatcattttagcagctcct
acaggaaaagctgcaaaacgcatgacagaaattactggaaaacactcggtaactatccat
gcactattacaatatgattttaaaacacggtcttttcgtaagaactacgaaaaccctata
gattgcgatctcatcattgtcgatgaatctggaatgatggatacctatcttttatatcat
ttcttaaaagctcttcctgatcatgtgatcgttatattcattggagatgtacaccaactt
cctagtatcggccctggcaatatcctaaaagatattatcaattctaaaaagattaccgtg
actaagctcaataagattttccgtcaggtccacgactctaacatcattatcaatgctcat
aaagtcaatgaaggtgagtttcctgtcctatattctgaatcaggccggaaagatttctta
tttttccaaaaggaagatcctcaagaagctgtagaccatattgtccatctagtgacacag
ttcatccctaagaaataccatatctatcccaaagatattcaaattcttgcgcccatgaaa
aagggggtcttaggaattcataatcttaatcgagtcctaaaatccgctttaaatcctaag
caggcaactctccacgggaggtttcattcctatgctgtaggagataaggttatgcaaatc
cgcaacaactacaataaagaaatatttaatggagatattgggtatatctctatgattaac
tttgaaaataaacgcgttgtagtgaatatggaaggaaagtatgtcgtctattccttctca
gagcttgatgatttggttttagcctatgctacctcagtgcataaataccaaggaagtgaa
agtccgtgtattatcctccctatacacacttcacattttatgatgctttacaggaatctg
ctctacacggccatcacgagaggaaaacaactcgtagtcttagtcggaacgaaaaaagcc
attgctatagccacaagaaatgataaggtacaacaccgctgtacgggactcttgcaagct
cttgaacaacttactcagccccaatatcaaacacattatcattaa

DBGET integrated database retrieval system