KEGG   Chlamydia psittaci 01DC12: BN356_7761Help
Entry
BN356_7761        CDS       T02343                                 

Gene name
sucC
Definition
succinyl-CoA synthetase beta chain
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cpsd  Chlamydia psittaci 01DC12
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpsd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN356_7761 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN356_7761 (sucC)
   00640 Propanoate metabolism
    BN356_7761 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BN356_7761 (sucC)
Enzymes [BR:cpsd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BN356_7761 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(898018..899178)
Genome map
AA seq 386 aa AA seqDB search
MHLHEYQAKDLLASYNIAIPPYRVASSVEEGRHTLNELGISAGVIKVQVHAGGRGKNGGV
IVAKSPDEILAAVDKLLHMRFTSNQTSGEALPVEKVLITPLVNIATEYYLAVIMDRKNRC
PAIMLSRAGGVDIEEVAQKYPDQLLTIPLTPFARIYNYQLRQMIKFMGWEGDTGKQGVQL
IKSLVQCFYDNDASLLEINPLVLTQEGDLLVLDAKVTIDDNALYRHPKLEVLYDPSQENV
RDVLAKQIGLSYIALDGNIGCLVNGAGLAMSTLDILKIHGGSAANFLDVGGSATEQQIQE
AVSLVLSDENVEVLFINIFGGIMDCSAVASGLVAVMQTRENLIPTVVRLEGTNVELGKEI
VQRSGIPCKFTDSLNTGAQLAVALSK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttcatgaataccaagctaaagacctcttagcctcttataatatagctattcct
ccttatcgtgtagcctcgtctgttgaagaaggtaggcatacgctcaatgagttaggaatc
agcgcaggtgtgattaaagtacaagtacatgctggaggtagggggaaaaacggtggtgtc
attgttgcgaaatctcctgatgagattcttgcagctgtggataaattgttacacatgcgt
tttaccagtaatcaaacttctggagaagctttacctgtagagaaagttctgatcacaccc
ttagtgaatattgctactgagtattacttagcagtaatcatggataggaaaaatcgctgc
ccagcgattatgttatcgagagccggaggtgttgatattgaagaggtagctcaaaaatat
cctgaccaattgcttactatacccctgactccttttgctcgtatatataattatcaactt
agacagatgattaaatttatgggttgggaaggcgatacagggaaacaaggcgtacagctg
attaaaagtcttgttcaatgtttctatgataatgatgcttctttactggaaattaatcct
ttagtgcttactcaagaaggagatcttcttgtactagatgctaaagtcactattgatgat
aacgccttataccgtcatccaaaacttgaagtattgtacgacccttctcaagaaaatgtt
cgtgatgtacttgctaagcagataggactttcctacattgctctagatggcaatattggg
tgcttagttaatggcgccggattagctatgagcacattagacattcttaagattcatgga
ggatctgcagcaaatttccttgatgtaggcgggagcgctacggaacaacaaattcaagaa
gccgtatctttagtgctatcagacgaaaatgtagaggttctttttatcaatattttcggt
ggcattatggattgttctgcagttgcctcgggacttgttgctgtgatgcaaactagggaa
aatctcattcctacagtagtgcgtttagaaggaacaaatgtagaacttggcaaagaaatt
gtacagcgttcaggaatcccctgtaaatttaccgattccttaaatacgggcgcacagctt
gctgtagcattaagtaaataa

DBGET integrated database retrieval system