KEGG   Chlamydia psittaci 01DC12: BN356_8651Help
Entry
BN356_8651        CDS       T02343                                 

Definition
putative protoporphyrinogen-related protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cpsd  Chlamydia psittaci 01DC12
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpsd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN356_8651
Enzymes [BR:cpsd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BN356_8651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1008277..1009545
Genome map
AA seq 422 aa AA seqDB search
MKKAIIIGAGISGLSTAWWLHRKFPNSELVIIDKADRPGGLIYSDYQKNFALDLGPKGFL
VRGEGQYTLGLIRDLQLEEALIVSDKTAKKRFIRYKGKTRKVSPWTLIKEGLPFAIIKDL
FASRYTKDSSVYDFLSRHSTINLIHNVLNPVVTAIRAGHSHLLSAHMAFPSLSQREAKTG
SILRSFLKEPSKKKTSGAPYLASLRPNLGILIDTLVKKLPATWKFSSPVTKIECFPSQVV
VSTTQETFSGDLAIYTGATSLLPSLINIPGLQQLANKTLHWDLSCATLGWNRDMPSIPKG
YGMLFSDEPPLLGIVYNSRVFPNQMPEKTVLSLLLENRWHQEEAFAFSLAAISEYLGIST
QPDVFSLFSPEEGLPQHGVGFLEMKNQILPVLPHNLKIVGQNFSGPGLNRCVASAYQTVA
AI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagccattatcataggcgcaggaatttcagggttatccacagcgtggtggtta
cataggaaattccccaatagcgaacttgtaattatagataaggcagatcgacctggtggg
cttatctactcagattaccaaaagaattttgccttggatctcgggcctaaaggttttcta
gtacgtggtgagggacagtataccctcggattaattcgtgatttacaactggaagaggct
ctcattgttagtgataaaaccgcgaaaaaacgttttatacgttacaaagggaaaacacga
aaagtctccccatggacattaataaaagaaggtttgcctttcgctatcatcaaagatctc
tttgcctcccgctatacaaaagatagctctgtatatgatttcctaagtcgccatagcaca
ataaatcttattcacaatgtattaaatcctgttgttaccgcaattcgtgcaggacacagt
catctactttctgctcatatggccttcccttccctttctcaacgcgaagcaaaaacagga
tccattttacgcagcttcttaaaagaaccttcgaagaaaaaaacatccggagctccttat
ctagcttcgctacgtcccaatctaggcatcctcattgatactttagtaaaaaaactaccc
gcaacgtggaagttttcttctcctgttacaaagatcgagtgtttcccatcccaggttgtc
gtatccactacacaagaaacattctcaggagatctagcaatatatacgggggccacgtct
ctacttccttctcttattaatattccaggactgcaacagcttgcgaataaaactcttcat
tgggatctctcgtgtgcaacattggggtggaatagggatatgccttctatccctaaaggt
tatggtatgctgttctctgacgaaccaccgttattaggtattgtctataactctcgagta
ttccctaaccagatgcctgagaaaacagttctatcattactattagaaaaccgctggcat
caagaagaagctttcgctttttctttagcagcgatttctgagtatttagggatttctaca
caacccgatgtattttcattattttccccagaagaaggtctacctcaacacggcgtaggg
tttttagaaatgaaaaatcagatactccctgtacttcctcataatctaaaaattgtcggg
caaaacttctctggtccaggattaaacagatgtgtagcctcagcctatcagaccgttgct
gctatctaa

DBGET integrated database retrieval system