KEGG   Chlamydia psittaci 01DC12: BN356_9951Help
Entry
BN356_9951        CDS       T02343                                 

Gene name
recD
Definition
exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpsd  Chlamydia psittaci 01DC12
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpsd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1162983..1164497)
Genome map
AA seq 504 aa AA seqDB search
MLSLSPDVSHLLYDVVQQQIVLPLDLAFAKRHISPESKKAFAFLAISSALWRCGYPFLSI
ENERLFPSVSGISEKLFYEYFQALPHDVLSSLCVIENNKIYLKSLYTVREKLFKKLSLLS
QASNRYSLTTTTLSSLSREQNEVFHKAVNSCFSLICGGPGTGKTFLAVQIIIALIKQYPK
IRIAIVSPTGKATSHIRHILSKHHISESSVTIQTIHRFLQEHAYHQCASFDLLLVDEGSM
VTFSLLHSLVNTLSGENKHGKIIADNLIILGDENQLPPIGVGAGNPLQDLIARFPERALH
LHVSHRAKTNRVQNFARAVLERQAIPFTPLPPMLTALSMIKEAFINTPSSQTQLCVLTPM
RHGPWGYLRLNELLFHEIQKTHPELPIPIMITERYEAWGLFNGDTGHLCPKTQKLFFSHS
RFIDAKEFSYYTYNYAMSVHKSQGSEYEDVIVIIPKGCETFDISILYTAITRAKNNIDVW
ADRETLYKIIKKPHKYTYGVDRLL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgctttcgttaagcccggatgtttctcaccttctttatgatgtagttcaacaacagatt
gttctacctttggacctagcttttgcgaagcgccatatctctccagaatcaaaaaaagcg
tttgcatttctggctatttcttctgctctttggcgttgtggttatccctttcttagtata
gaaaatgagcgtttattcccttcagtatccggaatttctgaaaagctgttttatgaatat
tttcaggctcttcctcacgatgttttgtcgtcgttgtgtgtgatagaaaataataaaatt
tatttaaaatctttatatacagttcgtgagaaactttttaaaaaactctctttgttgtca
caagcttctaatcggtacagcctgactacaacaactctgtcgagtttatctcgggagcaa
aatgaggtttttcacaaagctgttaacagttgtttttctttgatctgtggtggtccggga
acagggaagacatttcttgctgtacagataatcatcgcgttaattaagcagtatcctaaa
atccgtattgctatagtctctcctacaggaaaagcaacctctcatatccgtcacatactc
tctaaacatcatatttctgagtctagtgtcacaatccaaacaatacaccgattcttgcaa
gaacatgcgtatcaccagtgcgcttcttttgatttattattagttgatgaggggtctatg
gtgacatttagtcttctgcatagcctagtcaacactttatcaggggaaaataaacacggg
aaaatcattgctgataatttaattatattgggagatgagaatcagctcccccccataggt
gttggcgccggaaatcctcttcaagatttgatagcacgtttccctgaaagagctctacat
cttcatgtttctcacagagctaaaacaaatagagttcaaaattttgctagagctgtttta
gaaagacaagccattccttttacccctttgcctcctatgctcactgcactttctatgatt
aaagaggcgtttataaataccccctcatctcaaacacaattgtgtgttttaactcctatg
cgacatggtccttggggatacctacgcttaaatgaactgctctttcatgaaatacaaaaa
acacatccagagttacccattcctattatgataacagaacgttatgaagcttgggggcta
tttaatggtgatacggggcacctttgcccaaagacgcaaaagttatttttttctcactct
cgctttatcgatgccaaagagttttcttattatacctataactacgctatgtcagtgcat
aaaagtcagggaagtgagtacgaggacgtcattgttattatccctaaagggtgtgaaact
tttgacatttctattctttacacagcgatcacacgtgcaaagaacaacatagatgtgtgg
gctgatcgagagacgttgtataagatcataaaaaaaccccataagtatacttatggggta
gatcgtcttctttag

DBGET integrated database retrieval system