KEGG   Chlamydia psittaci GR9: B598_0410Help
Entry
B598_0410         CDS       T02309                                 

Gene name
murE
Definition
UDP-N-acetylmuramyl-tripeptide synthetases family protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cpsg  Chlamydia psittaci GR9
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cpsg00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cpsg00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
419765..421216
Genome map
AA seq 483 aa AA seqDB search
MNLKELLHNTKAKIYGKISSVEVRNLTRDSRNVGVGDIFIASKGKHSDGNDFSHLAIENG
AIAVASSIYNPFLPVVQIISSDLPQLEADLAAKYYGHPSQKLCVVGITGTNGKTTVSHLI
KFLFDACDKPAGLIGTIEHILGNSRIQDGYTTPESCLLQKYLAEMVKSNLSAAVMEVSSI
GLAVNRLANVHFDVGVLTNITLDHLDFHSSFEEYKQAKLKLFSMLPSSGLAVVNNDLHYA
AQFIEATQAQPITYGIEQHADYRASNLRFSPFGTDFDLLYKGETFACSSPLIGQHNIYNV
LAAISVAHQRLGCDLQQLISAVANVETPRGRLEPVFSGPCPIYIDYAHTPDALDNVCKTL
QALLPQDGRLIVVFGCGGDRDQSKRKIMAQVVEKYGFAVVTTDNPRGEDPEMIINEICSG
FFKRNFSIEIDRKQAITYALSIASDRDIVLVAGKGHETYQIFKHQTIAFDDKEIVLEVLS
SYV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaaagaactcctccacaataccaaagcgaaaatttatgggaaaatttcttct
gtagaagtaagaaatctcacaagagattctcgtaatgttggagttggagatatctttata
gccagtaaaggcaagcactctgatggtaatgacttttcccatttagctattgaaaatgga
gctattgctgtagcttcttctatttacaatccttttttacctgttgttcaaattatttct
tccgatcttcctcagcttgaagcggatcttgcagcaaaatactacggtcatccttcgcaa
aaactctgtgtggttggtattacaggcaccaatgggaaaactacagtttcccatttaata
aaatttctgtttgatgcttgcgacaagcctgcaggcttaataggtactattgagcatatt
ctgggaaatagtcgtattcaagatgggtataccactcctgaatcctgtttgttgcaaaag
tatttagctgagatggtgaagagcaatctttctgctgcagttatggaagtatcttctatc
ggtcttgctgtcaacagactggctaacgtccattttgatgttggtgtcttaactaacatt
actctagatcatttagattttcattcttcgtttgaagagtataaacaagcaaagcttaag
ctattttcgatgcttccttcttcaggtctagctgtagtgaataacgacttacattatgct
gcgcagtttattgaagctacccaagcccaacctattacctatggaatcgagcagcatgca
gattatcgcgcttctaatttgcgcttttctccgttcggaacggattttgacttactctat
aaaggggaaacctttgcatgttcctcacccttaatagggcagcacaacatttataatgtt
cttgctgcgatttctgtcgctcaccaacgattaggttgtgatttacaacaactgatctct
gctgttgccaatgtagaaacccctagagggcggttagaacctgtattttccggcccctgt
cctatttacattgattatgctcatactcccgatgccttagataatgtatgcaaaacactc
caagctctacttccccaagatggaaggcttatcgtggtctttggatgtggaggcgatcga
gatcagagcaaaagaaaaatcatggctcaagtcgtcgagaagtatggattcgctgttgtg
actacggacaatcctcgcggcgaagatccagaaatgatcattaatgaaatttgttcaggt
ttttttaaaagaaatttttctatcgaaatcgacagaaaacaagcaattacatatgctttg
tccattgcctcagatagggatatagtgttagtggcaggtaaagggcatgagacgtaccag
atctttaaacatcaaaccatcgcttttgatgataaggaaatcgtgctcgaggtattgtcg
tcttatgtttaa

DBGET integrated database retrieval system