KEGG   Chlamydia psittaci MN: B599_0406Help
Entry
B599_0406         CDS       T02311                                 

Gene name
murE
Definition
UDP-N-acetylmuramyl-tripeptide synthetases family protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cpsi  Chlamydia psittaci MN
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cpsi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    B599_0406 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B599_0406 (murE)
Enzymes [BR:cpsi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     B599_0406 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
422818..424269
Genome map
AA seq 483 aa AA seqDB search
MNLKELLHNTKAKIYGKISSVEVRNLTRDSRNVGVGDIFIASKGKHSDGNDFSHLAIENG
AIAVASSIYNPFLPVVQIISSDLPQLEADLAAKYYGHPSQKLCVVGITGTNGKTTVSHLI
KFLFDACDKPAGLIGTIEHILGNSRIQDGYTTPESCLLQKYLAEMVKSNLSAAVMEVSSI
GLAVNRLANVHFDVGVLTNITLDHLDFHSSFEEYKQAKLKLFSMLPSSGLAVVNNDLHYA
AQFIEATQAQPITYGIEKHADYRASNLRFSPFGTDFDLLYKGETFACSSPLIGQHNIYNV
LAAISVAHQRLGCDLQQLISAVANVETPRGRLEPVFSGPCPIYIDYAHTPDALDNVCKTL
QALLPQDGRLIVVFGCGGDRDQSKRKIMAQVVEKYGFAVVTTDNPRGEDPEMIINEICSG
FLKRNFSIEIDRKQAITYALSIASDRDIVLVAGKGHETYQIFKHQTIAFDDKEIVLEVLS
SYV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaaagaactcctccacaataccaaagcgaaaatttatgggaaaatttcttct
gtagaagtaagaaatctcacaagagattctcgtaatgttggagttggagatatctttata
gccagtaaaggcaagcactctgatggtaatgacttttcccatttagctattgaaaatgga
gctattgctgtagcttcttctatttacaatccttttttacctgttgttcaaattatttct
tccgatcttcctcagcttgaagcggatcttgcagcaaaatactacggtcatccttcgcaa
aaactctgtgtggttggtattacaggcaccaatgggaaaactacagtttcccatttaata
aaatttctgtttgatgcttgcgacaagcctgcaggcttaataggtactattgagcatatt
ctgggaaatagtcgtattcaagatgggtataccactcctgaatcctgtttgttgcaaaag
tatttagctgagatggtgaagagcaatctttctgctgcggttatggaagtatcttctatc
ggtcttgctgtcaacagactagctaacgtccattttgatgttggtgtcttaactaatatc
actctagatcatttagattttcattcttcgtttgaagagtataaacaagcaaagcttaag
ctattttcgatgcttccttcttcaggtctagctgtagtgaataacgacttacattatgct
gcgcagtttattgaagctacccaagcccaacctattacctatggaatcgagaagcatgcg
gattatcgcgcttctaatttgcgcttttctccgttcggaacggattttgacttactctat
aaaggggaaacctttgcatgttcctcacccttaatagggcagcacaacatttataatgtt
cttgctgcgatttctgtcgctcaccaacgattaggttgtgatttacaacaactgatctct
gctgttgccaatgtagaaacccctagagggcggttagaacctgtattttccggtccctgt
cctatttacattgattatgctcatactcccgatgccttagataatgtatgcaaaacactc
caagctctacttccccaagatggaaggcttatcgtggtctttgggtgtggaggcgatcga
gatcagagcaaaagaaaaatcatggctcaagtcgtcgagaagtatggattcgctgttgtg
actacggacaatcctcgcggcgaagatccagaaatgatcattaatgaaatttgttcaggt
tttttaaaaagaaatttttctatcgaaatcgacagaaaacaagcaattacatatgctttg
tccattgcctcagatagggatatagtgttagtggcaggtaaagggcatgagacgtaccag
atctttaaacatcaaaccatcgcttttgatgataaggaaatcgtgctcgaggtattgtcg
tcttatgtttaa

DBGET integrated database retrieval system