KEGG   Chlamydia psittaci MN: B599_0456Help
Entry
B599_0456         CDS       T02311                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpsi  Chlamydia psittaci MN
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cpsi01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cpsi00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cpsi00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
470446..471543
Genome map
AA seq 365 aa AA seqDB search
MITEVRIPNVAESISEVTIASLLVTSESLVQENQGIMEIESDKVNQLIYAPISGRIVWSV
AEGDVVAVGGIVAKIYDANESVSESTAKETPVEETVDAEIINFPRSTAHNPPSEGKTFVP
LREKMQEEPQRSGAKNEVRERMSSIRKTISRRLVTALHESAMLTTFNEIHMTPLMQLRKE
KQEAFSSRYNVKLGLMSFFIKAVIEALKAYPRVNAYIDGDEIVYRQYYDISIAVGTERGL
VVPVIRECDKLSSGDIEVKLADLASRARDGLISLPELEGGSFTITNGGVYGSLLSTPIIN
PTQVGILGMHKIEKRPVVIDNTIAIADMMYVAFSYDHRIIDGKEAVGFLIKIKDAIEQPE
GLLDF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgattacagaagtacgcattccaaatgtcgctgaatccataagcgaagtcaccatagct
tctcttttggtgacttcagagagtctggttcaggagaatcaaggcattatggagatcgaa
agcgataaggtaaatcaacttatctatgctcctatatcgggaaggatcgtttggtctgtc
gctgaaggagacgttgttgccgtcggtggaatcgttgctaagatctatgatgctaatgaa
tctgtttccgaaagtacagcgaaggaaactccggtagaggagacagtagatgcggagatt
attaatttcccgaggtctacagctcacaatcctccttctgagggaaaaacatttgttcct
ttacgtgagaaaatgcaagaagaaccgcaacgttcgggagctaaaaatgaggttcgtgag
cgtatgtcatccatacgcaaaacgatttctcgacgtttagttacagctcttcatgaatca
gcaatgttaacaacattcaatgagattcatatgacccctctgatgcaacttcggaaggaa
aaacaagaggccttttcttctcgctataatgtgaaactcggtttgatgtcctttttcata
aaagcagttattgaagctctgaaggcttatcctcgtgtaaatgcgtatattgatggcgat
gagattgtctatcgtcagtattacgatatttccattgctgtaggaacagaacgcggtctt
gttgtccctgtgattcgtgagtgcgataaactctctagtggcgatatcgaagtgaaactt
gcagatttggcaagtagagctcgagatggtttaatttctcttccagagttagaaggagga
agtttcactattaccaatggtggggtgtatggttccttactttctacgccgattatcaat
cctactcaagtggggatattgggaatgcacaaaatagaaaaacgccctgtagtgatcgat
aatacaatcgccattgcggatatgatgtatgttgcctttagctacgaccatcgtatcatc
gatggtaaagaggcggttggtttccttatcaaaatcaaagatgctatagaacaaccagaa
gggttacttgatttttaa

DBGET integrated database retrieval system