KEGG   Chlamydia psittaci MN: B599_0480Help
Entry
B599_0480         CDS       T02311                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cpsi  Chlamydia psittaci MN
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cpsi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
495364..496503
Genome map
AA seq 379 aa AA seqDB search
MKHLAIFGSTGSVGQQALAIIRSLPHLFNVVALASYGNKRDLFFEQIREFSPSIVSVYDE
QLYFEILKEFPKVQVFLGEEGLLAAATANEIDTIVAASSGIVALPAIVAAMKLGKTLALA
NKEVLVSAGEIINKFAKQYQTRILPIDSEHNALYQCLEGRDTSEVRKLFLTASGGPLLYK
SKEELTRVTIQDVLKHPIWNMGTKITVDSSTLVNKGLEIIEAYWLFGLEHAEIDAVIHPQ
SLIHGMVEFEDGTVLSVMNPPSMLFPIQHVLTTPKRCPAPHKGMDFSIKHTLEFFPIDEE
RFPSIALARQVLKDKGSLGPFFNAANEILVQRFLKKEIAWCDILDKLTRLMKNHRVSSCT
SLDDVFSVDKEARALAQEI
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacatttagctatttttggatccacgggaagtgtaggacagcaggctttagcaatc
attcgctcgcttcctcatttgttcaatgtggttgctcttgcttcatacggtaataagaga
gatctattttttgaacaaattcgagaattttctccttctatagtttctgtatacgatgaa
cagctatattttgaaattctcaaggagttccctaaagttcaagtatttcttggtgaagaa
ggattgctagctgctgctacagctaacgaaatagacactattgttgctgcatcttcgggg
atagtcgctttacctgcaattgttgctgctatgaagttagggaaaaccctagcattagcc
aataaagaagttttggtttctgcaggagaaatcattaacaaatttgctaagcaatatcaa
actaggattttgccaatagatagtgagcacaatgctttatatcaatgtttagaagggaga
gatacctcggaagtcagaaagttgtttttaacagcttctggaggtcctttattatacaaa
tctaaagaagaattaacccgtgtaactattcaggacgtattgaagcatcctatatggaat
atggggactaagattaccgtagattcttcaacattggtaaataaaggcttagaaataatt
gaggcgtattggttatttggattagaacatgcagagatagatgctgtaattcatcctcaa
agtttaattcatggtatggtagagtttgaggacggaacggtgctttctgtaatgaatcct
cccagtatgcttttccccatacaacatgtattaacaaccccgaaacgctgtccagcacct
cataaaggaatggatttttctatcaaacacacattagaattctttcctatagatgaggag
cgtttcccaagcattgctttggcgagacaagtattaaaagataaaggatccttaggacca
ttttttaatgctgctaacgagatcttagttcaaagatttttgaaaaaagaaattgcttgg
tgcgatattctagataagctaacaagacttatgaaaaatcatagagtttcttcgtgcacc
tcgttagatgatgtcttttctgttgataaagaagctcgagcccttgctcaagagatataa

DBGET integrated database retrieval system