KEGG   Chlamydia psittaci MN: B599_0495Help
Entry
B599_0495         CDS       T02311                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cpsi  Chlamydia psittaci MN
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cpsi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(511023..512615)
Genome map
AA seq 530 aa AA seqDB search
MTPFSKALRYIQDSPAKHNWKPLGTMPKHGICVPLFSLHTKNSCGIGEFLDLLPLISWCQ
KHKLQIIQILPINDSGEDSSPYNSISSVALNPLYLSLASLPHVQSIPHAQSKLKTMQALS
QLPYVHYPQVKVAKWEFLQDYYQYVVKIGALKDEEFLIFCEKEKYWLRPYTVFRSIKSYL
KGAPINNWAKAYTDRTNFSKFEKQFQKESEFFSYLQFLCFQQMSQVKSYADDHQILLKGD
LPILISKDSCDVWYYRQFFSSSGSAGAPPDIYNIEGQNWHLPVYHMHNLAQDNYTWWKAR
LRYAENFYSLYRLDHIVGFFRLWVWDSSGNGKFQPEDASEYLRQGTDILKHILRASRMLP
IGEDLGSVPSDIKHTLLKLGICGTRIPRWERNWEGDGSFIPLDQYSPLSVTSLSTHDSDT
LALWWRHAPKEARKFAKFLGIPFTPVLSEEDQKHILKVSHKTSSIFHINLINDYLALCPD
LVSDNLKYERINIPGTVSKNNWVYRIKPSMEEIVTHDAFNAHLSEIFADL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgacgccattttctaaagctttacgctatattcaagactctccagctaagcacaactgg
aaacctttaggcaccatgcccaagcatggaatttgtgttccgttattttctctacatacc
aaaaatagctgtggcattggcgaattcttagatctccttcctctgatttcttggtgccaa
aaacataagttacagatcatacagattcttcctattaacgatagcggtgaagatagtagc
ccttacaacagcatatcttcagtcgctctcaatcccctttatctttccttagcaagcctt
ccccacgttcagtctattccccatgctcagtctaagttaaagacaatgcaagcactatct
caacttccttatgtgcactacccacaagtcaaagttgcaaaatgggaatttcttcaagac
tactatcaatacgtagtaaaaatcggtgctttaaaagatgaagaatttctgatcttttgt
gaaaaagaaaaatattggctacgtccctatacagtattccgttctataaaatcctatctc
aaaggagctccaataaataactgggcaaaagcctatacggataggacaaacttctcaaaa
tttgagaaacaattccaaaaagaatccgagtttttctcctatctccaattcctgtgcttt
cagcaaatgtctcaagtaaaatcctatgctgatgatcatcagattctacttaaaggcgat
cttcctattctcattagtaaggatagttgtgacgtttggtactatagacaattcttttcc
tcatcaggatcggcaggcgctcctcccgatatttacaatattgaagggcagaattggcac
cttcccgtttatcatatgcacaatttagcccaagataattacacctggtggaaagcacgt
ctccgctacgctgagaatttctactctctatacaggcttgatcatatcgtaggattcttt
cgtctatgggtgtgggactcttcaggaaatggaaagtttcaaccagaagatgcgagtgaa
tatcttcgccaaggcacagacatactgaagcacatactacgcgcatcccgcatgctccct
ataggagaagatttaggaagcgtgccttctgatataaaacacaccttgttaaaactaggc
atatgcggcacacgcattcctcggtgggaacgcaattgggaaggtgatgggagtttcatt
cccttagatcaatactcccctctatcagtgacttcattatccacacatgattcggataca
cttgctctttggtggcgacatgccccgaaagaagctcgaaaatttgcaaaatttttagga
ataccttttactcctgtcctctctgaggaagatcaaaaacatatcctaaaagtttctcac
aaaacatcatctatttttcatattaacttaattaacgactacctcgcactttgccctgat
ttagtatctgacaatctaaaatacgaacgcataaatataccgggaacagtatcaaaaaat
aattgggtatatagaatcaagccttccatggaagaaatagtcactcatgatgcgttcaat
gcgcatctctccgaaatatttgctgatctttaa

DBGET integrated database retrieval system