KEGG   Chlamydia psittaci MN: B599_0653Help
Entry
B599_0653         CDS       T02311                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpsi  Chlamydia psittaci MN
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:cpsi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cpsi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cpsi00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cpsi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cpsi00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism
Metabolism; Energy metabolism; Methane metabolism [PATH:cpsi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
680995..682653
Genome map
AA seq 552 aa AA seqDB search
MHVNSNDLNDVVIPGTPPLPRELQKFPSLIPTNDLRFSPKFDADVAKLFPNTYDSPYLKF
TSGTLDQPVRPLKVGVMLSGGPAPGGHNVIWGLLHSLKKIHPDSSLIGFLNNGQGILNNH
TVEITEEFMESFKNSGGFNCIGTGRTNIITEENKARCLKTVQALDLDGLVIIGGDGSNTA
TAILAEYFSQHHPKTCVVGVPKTIDGDLQHLFLDLTFGFDSATKFYSSIISNISRDTLSC
KAHYHVIKLMGRSASHIALECTLQTHPNITLIGEEIAEKNVPLNTIIHKVCSIIADRAAM
GKYYGIILIPEGIIEFIPEINNLVKEIERIPEDADKFSSLSRESQKLLKSFPETIAKQLL
NDRDAHGNVYVSKISVDKLLIHLVDNHLKKHFKNVPFNAISHFLGYEGRSCLPTKFDNTY
SYALGYGAGVLTYNRCNGYLTVIESLINIVDKWRLRAMPIVKMFTTKKKSDGTIKPLIKK
SLIDISSPAFIKFKLYRKIWALEDSYRFLGPLQIDTPPNSHSDHFPPLTLLLNHNEWQKR
CSICMEIPDCDY
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgaactccaatgatctcaacgacgtagttatcccaggtactcctcccctcccg
agggaactacaaaaattcccctctttgattccaacaaatgatttacgattttcccctaag
tttgatgccgacgttgctaagcttttcccgaatacctatgacagtccttacctaaaattt
acttcaggaactcttgaccaacctgttcgtccattaaaagtaggtgtgatgctatcggga
ggtcctgctcccggaggtcataatgttatttggggattacttcatagcttaaagaaaata
catcccgacagctcgctcattggctttcttaataacggccaagggattctcaataatcat
acagtagaaattaccgaagaattcatggagtctttcaaaaattccggaggattcaactgt
ataggcacaggaagaacaaacatcatcactgaagaaaataaagcccgatgcttaaaaaca
gtacaagctttagaccttgatggtttagtaattattggcggtgatggttcgaatacagca
acggctatcctagcagaatacttttctcagcatcatcctaaaacgtgcgttgtaggcgtc
ccaaaaactattgatggagatcttcaacatctatttttagaccttacctttggatttgat
tcagcaacaaaattttattcctccattattagcaacatttctagagatacgctatcctgc
aaagcgcattaccacgtgatcaagcttatgggacgctctgcatcgcacattgctttagaa
tgcactctacaaacccatccaaatatcactcttataggagaagaaatcgcagaaaagaat
gtgcctctaaatacgataatccataaagtctgttcgatcattgctgatagagccgctatg
gggaaatactatgggattattcttattcctgaaggcattatcgaattcatccccgagatt
aacaaccttgttaaagaaatcgaaagaatccctgaagatgcggataaattttcttctcta
tcccgtgaatctcaaaaattactaaaaagcttcccagaaactatcgctaaacaactcctt
aatgatcgtgatgctcacgggaacgtctatgtatctaaaatcagcgtggacaaattgctt
atccaccttgtagataaccacctgaagaaacattttaaaaatgttccgtttaatgcgatt
tctcattttttaggttatgagggaaggtcgtgcctacccacaaaattcgataatacctac
agctacgccctaggatatggcgcaggagttcttacgtataaccgctgcaacggctacctc
actgtcatcgaatcactgattaatattgtagataaatggcggctacgcgctatgcctatt
gtaaaaatgttcacaacaaagaaaaagtcggatggaactataaaacctctgataaagaag
agtttaattgatattagcagtcctgcttttattaagtttaaactctatagaaaaatatgg
gctctagaagattcttatcgttttttaggaccattacaaattgacaccccgcccaactct
cattccgatcatttccctcctcttactctcctcctcaatcataatgaatggcaaaaaagg
tgttctatatgtatggaaattcctgactgcgattattaa

DBGET integrated database retrieval system