KEGG   Chlamydia psittaci MN: B599_1068Help
Entry
B599_1068         CDS       T02311                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
cpsi  Chlamydia psittaci MN
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpsi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B599_1068 (folK)
Enzymes [BR:cpsi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     B599_1068 (folK)
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     B599_1068 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1154236..1155579)
Genome map
AA seq 447 aa AA seqDB search
MITKHFICLSLGSNLGNRFENFRRAFSLLKELGIEDLQSSIILETKALLLPDSPKEWDLP
FFNSVLIGRTALSPKELLSGIKHIERKLGRDPNALPWSPRILDVDILLYDDENYQQDDII
IPHHRMLERPFLLSLVASLCPTRKLHQPDSEFHLKTFGEIAHCLPCPQELILNSFSPTTF
LMGIVNVTDNSISDGGLYIDPSKAVAHAERLFAQGASVIDFGAQATNPKIKQLIDVDQEW
ARLEPVLKLLAEKWSGCMQYPDVSLDTFYPEIIKRALEIYPIRWINDVSGGSKEMAEIAR
DANLLLVINHSCSLPPRPDKTLAFTTCASDQLLSWGKQQIEAFVALGLSKDQIIFDPGIG
FGTTPIQALNVLHRMEKFRELGCATLVGHSRKSCFSLLGKYDAKDRDWETVSLSVLLQQQ
GVHYLRVHDVEANHRVLSAAAWPGVYV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgataaccaagcattttatttgtttatctctaggttccaatctaggaaaccgttttgaa
aattttcgtagagcattttctcttttaaaagagttgggcatagaagatttacaaagttcc
ataattttggagacaaaggctttattgttgcctgactcaccaaaagaatgggacttgcct
ttttttaattccgtacttattggaaggactgcactatctccaaaggagttattgtcaggg
atcaaacatatagaacgtaagcttggtagagatcctaatgccttaccttggtctcctagg
attctggatgtggatattctgttatatgatgatgaaaattaccaacaggatgacatcatc
atacctcatcataggatgttagaaagaccgttcttactttctcttgtggcatcgttatgc
cctactagaaaactccatcaaccagattctgaatttcacttaaaaacgtttggagaaata
gcccattgtctaccttgtcctcaggagcttattctgaatagcttttctcctactactttt
ttaatgggcatagtgaatgttacggataactccatttctgacgggggattatatattgat
ccttctaaagctgttgctcatgcagagagattatttgctcaaggggcttccgtaatagac
tttggtgcgcaagcaactaaccctaaaattaagcagttgattgacgtagatcaagagtgg
gcccgtttagagccggtactcaagcttttagcggaaaaatggtcaggatgtatgcaatat
ccagacgtttccttggatacattttatcctgagattattaagagagctttagaaatttat
ccaattcgatggataaatgatgtttctggcggctctaaagaaatggctgagattgccaga
gatgcgaatttattattagttatcaatcattcgtgttctcttcctccacgtcctgataaa
acgttagcttttaccacatgtgcttcagaccagttgctaagctggggaaagcagcaaatt
gaagcttttgttgctttgggattgagcaaagatcaaattatttttgacccaggaataggt
ttcggaacgactcccatacaagcattgaatgtattacacagaatggaaaaattccgagag
cttggttgcgctacgttggtagggcactcaaggaaatcgtgtttctctttgttggggaaa
tatgatgctaaagatcgtgattgggaaactgtgagcttatcggttttgttacaacagcaa
ggcgtgcattacttacgtgttcatgatgttgaagcaaaccacagggtcttatccgcagca
gcatggcctggggtttatgtgtaa

DBGET integrated database retrieval system