KEGG   Chlamydia psittaci M56: B602_0134Help
Entry
B602_0134         CDS       T02310                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cpsm  Chlamydia psittaci M56
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpsm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    B602_0134 (ruvA)
Enzymes [BR:cpsm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     B602_0134 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
124635..125258
Genome map
AA seq 207 aa AA seqDB search
MYDYIRGVLTYISSGTMVIESQGLGFSIFTPDRWLMELSSQLHRELIVYTYTVVRETEHV
LYGFNTRGERECFRMLISFSGVGPKTGLAILNTFSLSKLCSIARAEDIKAIASVPGIGKK
TAEKLMVDLKQKLADLLPLDSQITASWGPAKPSCMEEGIQALAALGYPKSSAERMIAEAM
SELPDHASIAEILPIALKKNLQGLNKS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactatattcgtggtgtgcttacttatatcagttcaggaactatggtaattgaa
agtcagggactggggtttagtatttttactcctgatagatggcttatggaattgtcaagt
caactacaccgcgagcttatagtctatacttatactgttgttcgtgaaactgagcatgtt
ctctatggatttaatactcgtggagaacgtgagtgtttccgtatgttaatttcattttca
ggagtgggacctaagacaggtttagcgattttaaatacattttctcttagcaaattgtgt
tctatagctcgtgctgaggatatcaaagctatagcttctgttccgggtatagggaagaaa
acagctgagaaacttatggtggatttgaagcaaaagcttgcagacttactccctttagat
tcgcaaatcaccgcttcttggggaccagcaaaaccttcttgtatggaagagggaatacaa
gctttagcagcattaggctatccaaaatcctcagcagagagaatgatcgccgaagctatg
agcgagctcccggatcatgcgtcaatagcagaaattcttcctattgctctaaagaagaat
ttacaaggtttgaacaagagctag

DBGET integrated database retrieval system