KEGG   Chlamydia psittaci M56: B602_0252Help
Entry
B602_0252         CDS       T02310                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cpsm  Chlamydia psittaci M56
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cpsm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(240232..240762)
Genome map
AA seq 176 aa AA seqDB search
MTIYLGLNQETANRYHARFVPILEIAPFARSSPQLRYALRYLEKTSHILLTSPSSTSLFI
SRMSRKNSKKTLSTKHYLCLGEITASRLTRLLPKAQYSLATIETGEGVLPMISSLPKNAR
ILYPHSVLSRPVIKDFFKKRKPKLFFLFPLHHSRTSITPLCIQSMQPCNFNQSLWS
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaccatatacctaggattaaatcaagaaacagcaaacagataccacgcccgcttcgtt
ccgattcttgagatcgctccatttgcaagaagctctcctcaactacgctacgccctacgt
tacctagagaaaacttctcatatcctgctcaccagtccatcttcaacatcactatttatt
tctagaatgagcagaaaaaattccaaaaagacgttatccaccaaacattacctttgttta
ggagaaatcacagcaagtcgccttacaaggcttctcccaaaagcacaatattccttagct
actattgaaacaggagagggtgtgctcccaatgatatcctctttacctaaaaacgctcgt
atcctctacccacactcagtcttgtcgcgccctgtaattaaagatttttttaaaaaaaga
aaaccgaagctttttttcctattcccactacaccattcgagaacgtctattacacccctc
tgtattcaatcaatgcagccgtgtaattttaaccagtccctctggagttag

DBGET integrated database retrieval system