KEGG   Chlamydia psittaci M56: B602_0458Help
Entry
B602_0458         CDS       T02310                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cpsm  Chlamydia psittaci M56
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cpsm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B602_0458 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B602_0458 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    B602_0458 (sucB)
Enzymes [BR:cpsm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     B602_0458 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
467356..468453
Genome map
AA seq 365 aa AA seqDB search
MITEVRIPNVAESISEVTIASLLVTSESLVQENQGIMEIESEKVNQLIYAPISGRIVWSV
AEGDVVAVGGIVAKIYDANESVSESTAKETPVEETVDAEIINFPRSTAHNPPSEGKTFVP
LREKMQEEPQRSGAKNEVRERMSSIRKTISRRLVTALHESAMLTTFNEIHMTPLMQLRKE
KQEAFSSRYNVKLGLMSFFIKAVIEALKAYPRVNAYIDGDEIVYRQYYDISIAVGTERGL
VVPVIRECDKLSSGDIEVKLADLASRARDGLISLPELEGGSFTITNGGVYGSLLSTPIIN
PPQVGILGMHKIEKRPVVIDNTIAIADMMYVAFSYDHRIIDGKEAVGFLIKIKDAIEQPE
GLLDF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagaagtacgcattccaaatgtcgctgaatccataagcgaagtcaccatagct
tctcttttggtgacttcagagagtctggttcaggagaatcaaggtattatggagatcgaa
agcgagaaggtaaatcaacttatctatgctcctatatcgggaaggatcgtttggtctgtc
gctgaaggagacgttgttgccgtcggtggaatcgttgctaagatctatgatgctaatgaa
tctgtttccgaaagtacagcgaaggaaactccggtagaggagacagtagatgcggagatt
attaatttcccgaggtctacagctcacaatcctccttctgagggaaagacatttgttcct
ttacgtgagaaaatgcaagaagaaccgcaacgttcgggagctaaaaatgaggttcgtgag
cgtatgtcatccatacgcaaaacgatttctcgacgtttagttacagctcttcatgaatca
gcaatgttaacaacattcaatgagattcatatgacccctctgatgcaacttcggaaggaa
aaacaagaggccttttcttctcgctataatgtgaaactcggtttgatgtcctttttcata
aaagcggttattgaagctctgaaggcttatccccgtgtaaatgcgtatattgatggcgat
gagattgtctatcgtcagtattacgatatttccattgctgtaggaacagaacgcggtctt
gttgtccctgtgattcgtgagtgcgataaactctctagtggcgatatcgaagtgaaactt
gcagatttggcaagtagagctcgagatggtttaatttctcttccagagttagaaggagga
agtttcactattaccaatggtggggtgtatggttccttactttctacgccgattatcaat
cctcctcaagtggggatattgggaatgcacaaaatagaaaaacgccccgtagtgatcgat
aatacaatcgccattgcggatatgatgtatgttgcctttagctacgaccatcgtatcatc
gatggtaaagaggcggttggtttccttatcaaaatcaaagatgctatagaacaaccagag
gggttacttgatttttaa

DBGET integrated database retrieval system