KEGG   Chlamydia psittaci M56: B602_0875Help
Entry
B602_0875         CDS       T02310                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cpsm  Chlamydia psittaci M56
Pathway
cpsm00900  Terpenoid backbone biosynthesis
cpsm01100  Metabolic pathways
cpsm01110  Biosynthesis of secondary metabolites
cpsm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpsm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B602_0875 (ispE)
Enzymes [BR:cpsm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     B602_0875 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AFS24662
Position
complement(930276..931151)
Genome map
AA seq 291 aa AA seqDB search
MDLFSPAKLNLFLKLHGKTAHGFHEMTTLYQVINFGDSLSLESGSEDSLICNLPELNTPQ
NLIWKSVQVFRDYTKIYSPVAWRLYKRIPIGSGMGGGSSNAATALYALNQHFQTQLSNDV
LQELGKKIGMDVPLFFSLGSALGIGCGEQILPYENDRGDERYVLYFSDQAVLTKDAFSYV
RPEDFSKREECLSLYERNNDLEKSVFRFRRDLEEKKDMLKRIWSPFDAHVSMSGAGATLF
VSYPKEIETDPSIVKAIHATIHNSQGMLVNSLRKYTGWFEHCDSLFTTTRQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggatcttttttctccagcaaaactcaatctctttttaaagcttcacggcaaaacagct
catggcttccacgagatgacaaccctataccaagtcatcaattttggagatagcctgagc
ttagagagtggtagtgaagattctcttatttgtaatctaccagaattaaatactcctcaa
aatctcatatggaaaagtgttcaggttttcagagactacaccaaaatctacagtcctgtt
gcttggcggttgtataagcgtattcctataggatctggtatgggaggcggcagtagcaat
gctgctacagcactctatgctttaaatcaacatttccaaacgcaactatctaatgatgtt
ctgcaagaactagggaaaaagattggcatggatgtccctctgttcttctcattgggatct
gctctaggcataggatgtggcgagcaaatccttccttacgaaaatgatcgtggtgatgaa
aggtatgttctctatttctcagaccaagctgtcttgactaaagacgctttttcttatgta
cgccccgaagatttttctaaaagggaagaatgcttatctttatacgagagaaacaatgat
ttagaaaagtccgtgtttcgttttcgtagggatcttgaagagaaaaaagacatgctaaaa
aggatatggagtccttttgatgctcacgttagtatgtctggggccggggcaacgctattt
gtaagttatcccaaggaaatcgaaacagacccctccatagttaaagctatccatgcaact
atccacaatagccagggtatgctcgtaaatagcttacgcaaatacactggatggtttgag
cattgcgatagtctatttacaacaacaagacaataa

DBGET integrated database retrieval system