KEGG   Chlamydia psittaci NJ1: B712_0297Help
Entry
B712_0297         CDS       T02252                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cpsn  Chlamydia psittaci NJ1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cpsn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
287401..289584
Genome map
AA seq 727 aa AA seqDB search
MVERIVNSEDVSLLISGRQSNPHKFLGIVSENSSQDRIILFRPGAHSVVVELQGNIAHAQ
HHHSGIFSLTAPKGTLPQDYRIYHQNGLLAHDPYAFSPLWGEVDSFLFHQGTHYKIYERM
GAIPYDVQGISGVLFVVWAPHAQRVSVVGDFNFWNGLVNPLRKVSDLGVWELFIPGLEEG
TLYKWEIVSASGEVLIKTDPYGKSFDAPPHAVSRVVHSDRYTWHDAQWMEKRKNREDQPL
AIYEVHVGSWQWHEGKPLGYRELAKKLSAYCKEMHYTHVELLPVTEHPLNESWGYQVTGY
YAPTFRYGSPEDFQFFVDHLHSENIGVILDWVPGHFPTDGFALAHFDGEALYESIEHKEP
LHPHWHTYTFDYRCNEVVNFLLGSALFWLDKMHIDGLRVDAVTSMLYLDYGRQEGEWSPN
IYGGRENLDAIEFLKHLNSVVHREFPGVWTFAEESTDFPNVTKPVAQGGLGFDYKWNLGW
MHDTFRYIQVDPMFRSYHHNDLTFSLWYAFNERYLLPLSHDEVVHGKGSLLQKMPGDDPW
TKFAHMRLLLSYHICQPGKKLLFMGGEFAQGKEWAPDSSLDWHLLDNSYHACLHRCVARM
NALYCDLPYFWKGDGKQESFHWVDFKDTENHVIAYYRFAGEDRSSALLCIHHFSSGYFPS
YVLHCQDINTCQLLFNSDDICFGGSGKGNRQPVLCIDQHVSWGVDIELPPLATLIFYVRF
VNKQSLV
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaaggattgtcaactctgaagacgtgtccttattaatttctggaaggcagagt
aatcctcataagtttttagggattgtttctgaaaactcctcacaggatagaatcattctc
tttcgtcctggggcccattctgtagttgtcgaactgcagggaaatatcgcgcatgcacaa
caccatcattcggggatattttctctaactgctcctaaggggactctccctcaggattat
cgtatctatcatcaaaatggcctattagctcacgatccttatgcgttttctcctttgtgg
ggagaagtagattcttttttatttcatcaaggtacgcactataagatttacgaacgtatg
ggagcgattccctatgatgttcagggaatttccggggtgctttttgtagtttgggctcca
catgcacaacgcgtatctgttgtcggtgattttaatttttggaatggtcttgttaatcct
ttgcgcaaagtctctgatttaggagtttgggaattatttatcccaggtcttgaagaagga
accctgtataaatgggaaattgttagcgcttccggagaggtgcttatcaaaactgaccct
tatgggaaaagttttgatgctcctcctcatgcagtatctcgcgttgtgcatagtgatcgc
tatacatggcatgacgctcagtggatggaaaaacgtaaaaacagagaagaccagccttta
gcaatttatgaggtgcatgtaggttcatggcagtggcatgagggtaaacctttaggatac
cgagagttagcaaagaaactctctgcctattgcaaagagatgcattatacgcacgttgag
ctattgccagttacagaacatcctttaaatgaatcttggggatatcaagtaacaggatac
tacgcacctacatttcggtatggatcacctgaagattttcagttttttgtagaccacctt
catagtgaaaatatcggggtgattttagattgggtgcctgggcacttccccacggatggc
tttgctttagctcatttcgacggagaagccctgtatgaatccatagaacataaagagcca
ttacacccccattggcatacgtatacttttgattatcgctgcaatgaagtcgtgaatttc
cttttaggcagcgctctattttggttagataaaatgcacatagatggtttacgtgtcgat
gctgtaacctcgatgttgtatttagattatggccgtcaagaaggagagtggtcccccaac
atctatggaggtagagagaatctcgatgctatcgagttcttgaaacacttgaattctgta
gtgcatagggaattccccggggtatggacatttgctgaggaatctacagattttccgaac
gtgaccaagccggtcgcccaaggagggttagggttcgattataaatggaacttaggttgg
atgcacgatacctttcgttatattcaggtcgatcctatgttccgttcgtatcaccataat
gatctgacctttagcctttggtatgcctttaacgaaaggtacctccttcctctttctcat
gatgaggttgtccatggtaaaggtagccttttacaaaaaatgcctggtgatgatccatgg
acaaagtttgcccatatgcgtttgctgttaagctatcacatatgccaaccgggcaagaaa
ctgctgtttatgggtggggaatttgctcaaggaaaagaatgggctccggatagctcttta
gattggcatctgttagataactcctatcacgcttgtttacacaggtgcgtggcacggatg
aatgctttatattgtgaccttccttatttttggaaaggagacggtaagcaagagtctttc
cattgggtagacttcaaagatactgaaaatcatgttatagcttactacagatttgcagga
gaagatcgtagtagcgctttactgtgtatccaccattttagttcgggatattttccttct
tatgttctacattgtcaggacataaatacctgccaactcctttttaatagcgatgatatt
tgctttgggggttcagggaaaggcaaccgtcagccagttctttgcatagatcagcatgtc
tcttggggggtggatatcgagctgccccctctagcaactttgattttttatgttcgtttt
gtaaataaacaatctcttgtttaa

DBGET integrated database retrieval system