KEGG   Chlamydia psittaci NJ1: B712_0500Help
Entry
B712_0500         CDS       T02252                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cpsn  Chlamydia psittaci NJ1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpsn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B712_0500 (malQ)
Enzymes [BR:cpsn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     B712_0500 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(505871..507463)
Genome map
AA seq 530 aa AA seqDB search
MTPFSKALRYIQDSPAKHNWKPLGTMPKHGICVPLFSLHTKNSCGIGEFLDLLPLISWCQ
KHKLQIIQILPINDSGEDSSPYNSISSVALNPLYLSLASLPHVQSIPHAQSKLKTMQALS
QLPYVHYPQVKVAKWEFLQDYYQYVVKIGALKDEEFLIFCEKEKYWLRPYTVFRSIKSYL
KGAPINNWAKAYTDRTNFSKFEKQFQKECEFFSYLQFLCFQQMSQVKSYADDHQILLKGD
LPILISKDSCDVWYYRQFFSSSGSAGAPPDIYNIEGQNWHLPVYHMHNLAQDNYTWWKAR
LRYAENFYSLYRLDHIVGFFRLWVWDSSGNGKFQPEDSNEYLRQGTDILKHILRASRMLP
IGEDLGSVPSDIKHTLLKLGICGTRIPRWERNWEGDGSFIPLDQYSPLSVTSLSTHDSDT
LALWWRHAPKEARKFAKFLGIPFTPVLSEEDQKHILKVSHKTSSIFHINLINDYLALCPD
LVSDNLKYERINIPGTVSKNNWVYRIKPSMEEIVTHDAFNAHLSEIFADL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgacgccattttctaaagctttacgctatattcaagactctccagctaagcacaactgg
aaacctttaggcaccatgcccaagcatggaatttgtgttccgttattttctctacatacc
aaaaatagctgtggcattggcgaattcttagatctccttcctctgatttcttggtgccaa
aaacataagttacagatcatacagattcttcctattaacgatagcggtgaagatagtagc
ccttacaacagcatatcttcagtcgctctcaatcctctttatctttccttagcaagcctt
ccccacgttcagtctattccccatgctcagtctaagttaaagacaatgcaagcactatct
caacttccttatgtgcactacccacaagtcaaagttgcaaaatgggaatttcttcaagac
tactatcaatacgtagtaaaaatcggtgctttaaaagatgaagagtttctgatcttttgt
gaaaaagaaaaatattggctacgtccctatacagtattccgttctataaaatcctatctc
aaaggagctccaataaataactgggcaaaagcctatacggataggacaaacttctcaaaa
tttgagaaacaattccaaaaagaatgcgagtttttctcctatctccaattcctgtgcttt
cagcaaatgtctcaagtaaaatcctatgctgatgatcatcagattctacttaaaggcgat
cttcctattctcattagtaaggatagttgtgatgtttggtactatagacaattcttttcc
tcatcaggatcggcaggcgcccctcccgatatttacaatattgaagggcagaattggcac
ctccccgtttatcatatgcacaatttagcccaagataattacacctggtggaaagcacgt
ctccgctacgctgagaatttctactctctatacaggcttgatcatatcgtaggattcttt
cgtctatgggtgtgggactcttcaggaaatggaaagtttcaaccagaagattcgaatgaa
tatcttcgccaaggcacagacatactgaagcacatactacgcgcatcccgcatgctccct
ataggagaagatttaggaagcgtgccttctgatataaaacacaccttgttaaaactaggc
atatgcggcacacgcattcctcggtgggaacgcaattgggaaggtgatgggagtttcatt
cccttagatcaatactcccctctatcagtgacctcattatccacacatgattcggataca
cttgctctttggtggcgacatgccccgaaagaagctcgaaaatttgcaaaatttctagga
ataccttttactcctgtcctctctgaggaagatcaaaaacatatcctaaaagtttctcac
aaaacatcatccatttttcatatcaacttaattaacgactacctcgcactttgccctgat
ttagtgtctgacaatctaaaatacgaacgcataaatataccgggaacagtatcaaaaaat
aattgggtatatagaatcaagccttccatggaagaaatagtcactcatgatgcgttcaat
gcgcatctctccgaaatatttgctgatctttaa

DBGET integrated database retrieval system