KEGG   Chlamydia psittaci NJ1: B712_0874Help
Entry
B712_0874         CDS       T02252                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cpsn  Chlamydia psittaci NJ1
Pathway
cpsn00900  Terpenoid backbone biosynthesis
cpsn01100  Metabolic pathways
cpsn01110  Biosynthesis of secondary metabolites
cpsn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cpsn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B712_0874 (ispE)
Enzymes [BR:cpsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     B712_0874 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AFS28377
Position
complement(930222..931097)
Genome map
AA seq 291 aa AA seqDB search
MDLFSPAKLNLFLKLHGKTAHGFHEMTTLYQVINFGDSLSLESSSEDSLICNLPELNTPQ
NLIWKSVQVFRDYTKIYSPVAWRLYKRIPIGSGMGGGSSNAATALYALNQHFQTQLSNDV
LQELGKKIGMDVPLFFSLGSALGIGCGEQILPYENDRGDERYVLYFSDQAVLTKDAFSYV
RPEDFSKREECLSLYERNNDLEKSVFRFRRDLEEKKDMLKRIWSPFDAHVSMSGAGATLF
VSYPKEIETDPSIVKAIHATIHNSQGMLVNSLRKYTGWFEHCDSLFTTTRQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggatcttttttctccagcaaaactcaatctctttttaaagcttcacggcaaaacagct
catggcttccacgagatgacaaccctataccaagtcatcaattttggagatagcctgagc
ttagagagtagtagtgaagattctcttatttgtaatctaccagaattaaatactcctcaa
aatctcatatggaaaagtgttcaggttttcagagactacaccaaaatctacagtcctgtt
gcttggcggttgtataagcgtattcctataggatctggtatgggaggcggcagtagcaat
gctgctacagcactctatgctttaaatcaacatttccaaacgcaactatctaatgatgtt
ctgcaagagctagggaaaaagattggcatggatgtccctctgttcttctcattgggatct
gctctaggcataggatgtggcgagcaaatccttccttacgaaaacgatcgtggcgatgaa
aggtatgtcctctatttctcagaccaagctgtcttgactaaagacgctttttcttatgta
cgccccgaagatttttctaaaagggaagaatgcttatctttatacgagagaaacaatgat
ttagaaaagtccgtgtttcgttttcgtagggatcttgaagagaaaaaagacatgctaaaa
aggatatggagtccttttgatgctcacgttagtatgtctggggccggggcaacgctattt
gtaagttatcccaaggaaatcgaaacagacccctccatagttaaagctatccatgcaact
atccacaatagccagggtatgctcgtaaatagcttacgcaaatacactggatggtttgag
cattgcgatagtctatttacaacaacaagacaataa

DBGET integrated database retrieval system