KEGG   Chlamydia psittaci NJ1: B712_0904Help
Entry
B712_0904         CDS       T02252                                 

Definition
inositol monophosphatase family protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cpsn  Chlamydia psittaci NJ1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpsn00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    B712_0904
Enzymes [BR:cpsn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     B712_0904
Transfer RNA biogenesis [BR:cpsn03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    B712_0904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
962395..963375
Genome map
AA seq 326 aa AA seqDB search
MPSYLLDYQRVAESIVEKTIAELIHYRQRLPLVPFWTKPDGSFVTPADYAVQYCLQKKLS
TTFPHIPFIGEEVLDPVSDKHKINSILEFIHRLDSQVTPEDLLETLSPNQEASTLYWLVD
PIDGTSGFIKNRFFASAVSLIYEDKPILAVMACPCTDRHTFKIYSAAKNYGVSLFGTAIE
TRHYLKSGETLTGKFCEASLAARNQQHHATRLLSLSLPGQPQACRVDSQYKYAMVAEGTV
DFFIRYPFAISQARAWDHAPGAFLVEESGGVVSDIFGNSLNYRREDFILENHPIILASGN
AEIHRITLDALQEQANIVSEENLLAY
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcttatttactagactatcaaagagttgcagaaagtatagttgagaaaaccatc
gccgagttaatccattatcgacaacgccttccgctagtccctttctggacaaaacccgac
gggtcttttgtcacacccgcagattatgctgtccaatactgccttcaaaaaaagctatca
acaacttttccacatattccgtttatcggggaagaagtcttagaccctgtaagcgataaa
cataaaattaatagtattttagaattcattcacagactagattctcaggtgacacctgag
gatctgttagaaacattaagccccaatcaagaagcctcgactttatactggcttgttgat
cctattgatggtacgtcaggatttattaaaaaccgtttttttgcctctgcagtatcctta
atttatgaggataagcctatactcgcggttatggcgtgcccatgcacagaccgccatact
tttaaaatctattctgctgctaaaaactatggggtttctttatttggtacggcaattgaa
actcggcattatttaaaatctggagaaacgctaacggggaagttttgtgaagcatctcta
gctgcacgtaaccaacagcaccatgctacacgcttattaagtctctccttgccagggcaa
ccccaagcttgtcgagttgacagtcaatacaaatatgctatggttgctgaaggcactgta
gacttttttatccgctacccctttgctatttctcaagcaagagcgtgggatcatgctcca
ggggcttttttagtagaagagtctgggggcgtagtttccgatatttttggaaattcgctc
aactatcgtcgagaagatttcattttagaaaaccatcccataattctagcttccgggaat
gcggaaattcacagaattacgttagacgccttacaagaacaagcaaacattgtttctgaa
gaaaacttgctagcttactaa

DBGET integrated database retrieval system