KEGG   Chlamydia psittaci NJ1: B712_1071Help
Entry
B712_1071         CDS       T02252                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
cpsn  Chlamydia psittaci NJ1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cpsn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1147178..1148521)
Genome map
AA seq 447 aa AA seqDB search
MITKHFICLSLGSNLGNRFENFRRAFSLLKELGIEDLQSSIILETKALLLPDSPKEWDLP
FFNSVLIGRTALSPKELLSGIKHIERKLGRDPNALPWSPRILDVDILLYGDENYQQDDII
IPHHRILERPFLLSLVASLCPTRKLHQPDSEFHLKTFGEIAHCLPCPQEIILNSFSPTTF
LMGIVNVTDNSISDGGLYIDPSKAVAHAERLFAQGASVIDFGAQATNPKIKQLIDVDQEW
ARLEPVLKLLAEKWSGCMQYPDVSLDTFYPEIIKRALEIYPIRWINDVSGGSKEMAEIAR
DANLLLVINHSCSLPPRPDKTLAFTTCASDQLLSWGKKQIEAFVALGLSKDQIIFDPGIG
FGTTPIQALNVLHRMEKFRELGCATLVGHSRKSCFSLLGKYDAKDRDWETVSLSVLLQQQ
GVNYLRVHDVEANHRVLSAAAWPGVYV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgataaccaagcattttatttgtttatctctaggttccaatctaggaaaccgttttgaa
aattttcgtagagcgttttctcttttaaaagagttgggcatagaagatttacaaagttcc
ataattttggagacaaaggctttattgttgcctgactcaccaaaagaatgggacttgcct
ttttttaattccgtacttattggaaggactgcactatctccaaaggagttattgtcaggg
atcaaacatatagaacgtaagcttggtagagatcctaatgccttaccttggtctcctagg
attctggatgtggatattctgttatatggtgatgaaaattaccaacaggatgacatcatc
atacctcatcataggattttagaaagaccgttcttactttctcttgtggcatcgttatgc
cctactagaaaactccatcaaccagattctgaatttcacttaaaaacgtttggagaaata
gcccattgtctaccttgtcctcaggagattattctgaatagcttttctcctactactttt
ttaatgggcatagtgaatgttacggataactccatttctgacgggggattatatattgat
ccttctaaagctgttgctcatgcagagcgattatttgctcaaggggcttccgtaatagac
tttggtgcgcaagcaactaaccctaaaattaagcagttgattgacgtagatcaagagtgg
gcccgtttagagccggtcctcaagcttttagcggaaaaatggtcaggatgtatgcaatat
ccagacgtttccttggatacattttatcctgagattattaagagagctttagaaatttat
ccaattcgatggataaatgatgtttctggcggctctaaagaaatggctgagattgccaga
gatgcgaatttattattagttatcaatcattcgtgttctcttcctccacgtcctgataaa
acgctagcttttaccacatgtgcttcagaccagttgctaagctggggaaagaagcaaatc
gaagcttttgttgctttaggattgagcaaagatcaaattatttttgacccaggaataggt
ttcggaacgactcccatacaagcattgaatgtattacacagaatggaaaaattccgagag
cttggttgcgctacgttggtagggcactcaagaaaatcgtgtttctctttgttggggaaa
tatgatgctaaagatcgtgattgggaaactgtgagcttatcggttttgttacaacagcaa
ggcgtgaattacttacgtgttcatgatgttgaagcaaaccacagggtcttatccgcagca
gcatggcctggggtttatgtgtaa

DBGET integrated database retrieval system