KEGG   Chlamydia psittaci WS/RT/E30: B601_0522Help
Entry
B601_0522         CDS       T02314                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cpst  Chlamydia psittaci WS/RT/E30
Pathway
cpst00010  Glycolysis / Gluconeogenesis
cpst00020  Citrate cycle (TCA cycle)
cpst00620  Pyruvate metabolism
cpst01100  Metabolic pathways
cpst01110  Biosynthesis of secondary metabolites
cpst01120  Microbial metabolism in diverse environments
cpst01130  Biosynthesis of antibiotics
cpst01200  Carbon metabolism
Module
cpst_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cpst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B601_0522
   00020 Citrate cycle (TCA cycle)
    B601_0522
   00620 Pyruvate metabolism
    B601_0522
Enzymes [BR:cpst01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B601_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AFS23441
Position
complement(530237..531523)
Genome map
AA seq 428 aa AA seqDB search
MISLLKMPKLSPTMEVGTIVKWHKNNGDKIEFGDVLLEVSTDKAVLEHTANEEGWFRDCL
VKEGTKVHIGTPIAVISSEKDEDFNLDTILPKTPEPELPVENVQLVEEEVTKVQPSVAPM
QLAFQFKPEPPLSKPLSLKVDSSKSPISPLAKRVAKEKNLDISGIKGSGPGGRIVEKDLD
KAPTKGIAGFGYPEAPEVHPGSYHEETLSPIRDIIAQRLQAAKASIPHFYVTQKVYASPL
LALLKELQAQGIKLSINDCIVRACALALKEFPEVNSGFNSVDNKIVRFETIDISIAVAIP
DGVITPIVRCADRKNIGMISAEIKSLASKAKSQSLKEEEYKGGSFCVSNLGMTGITAFTA
IINPPQAAILAVGSVQEEPIVINGEILVGSTCILTLSIDHRVIDGYPAAMFMKRLQKILE
APSILLLN
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgatttctctattaaaaatgccgaaactttctcccaccatggaagtaggaactatcgta
aaatggcataagaacaatggcgataaaatagagtttggtgatgttctcttagaagtatca
acagataaggctgtactcgagcatacggcaaatgaagaaggctggttccgggattgtctt
gttaaagagggaacaaaagtacacataggcacacctatagctgtcatatcttcggaaaag
gatgaggatttcaacttagacactatccttcctaaaactcccgagccagaacttcctgta
gaaaatgttcaactagtggaagaagaagtcacgaaagtgcaaccatccgttgcccccatg
cagttagcctttcaatttaaacctgaacctcccctgtctaaacctctatctttaaaagta
gattcttcaaaatcccccatttctcccctagctaaacgtgtagcgaaggaaaaaaacctg
gatatttctggaatcaaaggtagcggtcctggcggacgtattgttgaaaaagacctggat
aaagctcctaccaaaggtattgcaggttttggttaccctgaagctcctgaagtgcatcct
ggatcctatcacgaggaaactctttctcctattcgagacatcattgcacagaggttacaa
gctgcgaaagcctctattccacatttttatgtaacacaaaaagtttatgcttcgccgttg
ctcgccctgcttaaggaactacaggcccaaggaattaagctgtctattaatgactgtatt
gttcgtgcttgcgccctagctttaaaagagtttcctgaagtaaattcaggcttcaatagc
gtcgacaataaaattgtacgttttgaaactatagatatttcgatagctgtggctattcct
gatggagtgattactcctattgtacgctgtgctgatcgcaagaacataggtatgatttct
gccgagattaaaagcttagcttctaaagcgaaatctcaatctttaaaagaggaagagtat
aaaggtgggtctttctgcgtttccaatttaggcatgacaggaattacagcattcacagca
attatcaatccccctcaagcagctattcttgctgtgggtagtgttcaggaagagccgata
gtaatcaatggagaaattctagttggttctacgtgtatattgacattgtctatagatcac
cgtgtaattgacggatatccagccgcaatgtttatgaagcgattgcagaaaatcttagaa
gctccttctatcctgttattaaattaa

DBGET integrated database retrieval system