KEGG   Chlamydia psittaci VS225: B600_0205Help
Entry
B600_0205         CDS       T02312                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
cpsv  Chlamydia psittaci VS225
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpsv00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    B600_0205 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B600_0205 (murA)
Enzymes [BR:cpsv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     B600_0205 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
179524..180858
Genome map
AA seq 444 aa AA seqDB search
MAAAEVFGGCVLEGSVRVSGAKNSTTKLLVASLLSDRKCILRNVPDIGDVRLTVELCRSL
GSIIHWDKQAEVIEIHTPEIRMSEVSAQFSRVNRIPILLLGALLARCPEGVIVPCVGGDA
IGERTLNFHFEGLERLGAKVVYDGHGYQAAAPQGLVGAYITLPYPSVGATENLILASVRA
QGRTIIKNAALEVEILDLILFLQKAGVEITTDNDKTIEIFGCDDFYEVDHWVIPDKIEAA
SFGMAAVLTGGRIFVENAEQYLMIPFLKTLRSIGGGFSVTETGIEFFYNEPLKGGVVLET
DVHPGFLTDWQQPFSVLLSQAEGSSVIHETVHENRLGYLRGLQQMGANCELFYQCLSSKA
CRYATGNFPHSAVIHGATPLKASELVIPDLRAGFAYIMAALIAEGGPSLIRNTQLLDRGY
YNWVDKLNSLGAKIHLLSLDPVAF
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagctgaagtttttggtggttgtgtgttagaaggttctgtgcgggtatctggg
gccaaaaactcgacaaccaagttactcgttgcgtcattattatcggatcgcaaatgcatt
ttacgtaatgtccctgatataggagatgtacgtttaactgttgaattgtgccgttcttta
ggttctataatacattgggataaacaagcagaagtcatagagattcatacacctgagatt
cgcatgtccgaagtgtccgcacagttttctcgggtgaatcgtattcctattttattatta
ggagctctactagctcgctgtccggaaggcgttattgtcccctgtgtcgggggagatgct
ataggggaaaggactctaaattttcattttgagggtttagaacggctaggggcaaaggtt
gtctatgacggacatggatatcaagctgctgctcctcaaggtcttgtcggagcgtacatt
actcttccttacccttctgtaggagctactgagaatttgatattagcttctgttcgcgct
cagggaagaacgatcatcaagaacgctgctttagaagtagaaatcttggatcttattttg
tttttgcaaaaagcaggagtggagatcactacagataatgataagacgatagaaattttt
ggttgtgatgatttttacgaagtagatcactgggtgatccccgataagatagaagcggct
tcatttggtatggctgccgtgcttaccggcgggcgcatttttgtagaaaatgccgagcaa
tatctgatgattccttttcttaaaaccttaaggtctataggaggagggttctcagtgaca
gaaacaggaatcgaattcttttataacgaaccattaaaaggtggtgttgtattagaaacc
gatgtacatcctggattccttacagattggcaacaacctttttcagttcttctctctcag
gcagaaggatcttctgtgattcatgaaaccgtgcatgagaatcggctagggtatttacgc
ggtttacagcaaatgggagcgaattgcgagctgttctaccagtgtttaagctcaaaggct
tgtcgttatgcaaccggaaattttccccatagtgctgtcattcacggagcgacaccattg
aaagcttctgaactggttattcccgatttgcgtgcaggatttgcctatattatggcagct
ctcattgcagagggtggaccttctttaatcagaaatacccagttgttagatcggggatat
tacaattgggtggacaaactgaactctttaggagcaaagatccacttgttgtccttagat
cccgtagcgttctaa

DBGET integrated database retrieval system