KEGG   Chlamydia psittaci VS225: B600_0697Help
Entry
B600_0697         CDS       T02312                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpsv  Chlamydia psittaci VS225
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cpsv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    B600_0697
   01230 Biosynthesis of amino acids
    B600_0697
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B600_0697
   00030 Pentose phosphate pathway
    B600_0697
   00051 Fructose and mannose metabolism
    B600_0697
   00052 Galactose metabolism
    B600_0697
  Energy metabolism
   00680 Methane metabolism
    B600_0697
Enzymes [BR:cpsv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     B600_0697
Protein phosphatases and associated proteins [BR:cpsv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     B600_0697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
675342..677000
Genome map
AA seq 552 aa AA seqDB search
MHVNSNDLNDVVIPGTPPLPRELQKFPSLIPTNDLRFSPKFDADVAKLFPNTYDSPYLKF
TSGTLDQPVRPLKVGVMLSGGPAPGGHNVIWGLLHSLKKIHPDSSLIGFLNNGQGILNNH
TVEITEEFMESFKNSGGFNCIGTGRTNIITEENKARCLKTVQALDLDGLVIIGGDGSNTA
TAILAEYFSQHHPKTCVVGVPKTIDGDLQHLFLDLTFGFDSATKFYSSIISNISRDTLSC
KAHYHVIKLMGRSASHIALECTLQTHPNITLIGEEIAEKNVPLNTIIHKVCSIIADRAAM
GKYYGIILIPEGIIEFIPEINNLVKEIERIPEDADKFSSLSRESQKLLKSFPETIAKQLL
NDRDAHGNVYVSKISVDKLLIHLVDNHLKKHFKNVPFNAISHFLGYEGRSCLPTKFDNTY
SYALGYGAGVLTYNRCNGYLTVIESLINIVDKWRLRAMPIVKMFTTKKKSDGTIKPLIKK
SLIDISSPAFIKFKLYRKIWALEDSYRFLGPLQIDTPPNSHSDHFPPLTLLLNHNEWQKR
CSICMEIPDCDY
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtgaactccaatgatctcaacgacgtagttatcccaggtactcctcccctcccc
agggaactacaaaaattcccctctttgattccaacaaatgatttacgattttcccctaag
tttgatgccgacgttgctaagcttttcccgaatacctatgacagtccttacctaaaattt
acttcaggaactcttgaccaacctgttcgtccattaaaagtaggtgtgatgctatcggga
ggtcctgctcccggaggtcataatgttatttggggattacttcatagcttaaagaaaata
catcccgacagctcgctcattggctttcttaataacggccaagggattctcaataatcat
acagtagaaattaccgaagaattcatggagtctttcaaaaattccggaggattcaactgt
ataggcacaggaagaacaaacatcatcactgaagaaaataaagcccgatgcttaaaaaca
gtacaagctttagaccttgatggtttagtaattattggcggtgatggttcgaatacagca
acggctatcctagcagaatacttttctcagcatcatcctaaaacgtgcgttgtaggcgta
ccaaaaactattgatggagatcttcaacatctatttttagaccttacctttggatttgat
tcagcaacaaaattttattcctccattattagcaacatttctagagatacgctatcttgc
aaagcgcattaccacgtgatcaagcttatgggacgctctgcatcgcacattgctttagaa
tgcactctacaaacacatccaaatatcactcttataggagaagaaatcgcagaaaagaat
gtgcctctaaatacgataatccataaagtctgttcgatcattgctgatcgagccgctatg
gggaaatactatgggattattcttattcctgaaggcattatcgaattcatccctgagatt
aacaaccttgttaaagaaatcgaaagaatccctgaagatgcggataaattttcttctcta
tcccgtgaatctcaaaaattactaaaaagcttcccagaaactatcgctaaacaactcctt
aatgatcgtgatgctcacgggaacgtctatgtatctaaaatcagcgtggacaaattgctt
atccaccttgtagataaccacctgaagaaacattttaaaaatgttccgtttaatgcgatt
tctcattttttaggttatgagggaaggtcgtgcctacccacaaaattcgataatacctac
agctacgccctaggatatggcgcaggagttcttacgtataaccgctgcaacggctacctc
actgtcatcgaatcactgattaatattgtagataaatggcggctacgcgctatgcctatt
gtaaaaatgttcacaacaaagaaaaagtcggatggaactataaaacctctgataaagaag
agtttaattgatattagtagtcctgcttttattaagtttaaactctatagaaaaatatgg
gctctagaagattcttatcgttttttaggaccattacaaattgacaccccgcccaactct
cattccgatcatttccctcctcttactctcctcctcaatcataatgaatggcaaaaaagg
tgttctatatgtatggaaattcctgactgcgattattaa

DBGET integrated database retrieval system