KEGG   Chlamydia psittaci WC: B603_0137Help
Entry
B603_0137         CDS       T02313                                 

Gene name
ruvA
Definition
(GenBank) holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cpsw  Chlamydia psittaci WC
Pathway
cpsw03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpsw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    B603_0137 (ruvA)
Enzymes [BR:cpsw01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     B603_0137 (ruvA)
DNA repair and recombination proteins [BR:cpsw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     B603_0137 (ruvA)
    RecFOR pathway proteins
     B603_0137 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HHH_5 RuvA_N HHH IMS_HHH RuvA_C 5_3_exonuc HHH_8
Motif
Other DBs
NCBI-ProteinID: AFS25741
Position
124618..125241
Genome map
AA seq 207 aa AA seqDB search
MYDYIRGVLTYISSGTMVIESQGLGFSIFAPDRWLMELSSQLHRELIVYTYTVVRETEHV
LYGFNTRGERECFRMLISFSGVGPKTGLAILNTFSLSKLCSIARAEDIKAIASVPGIGKK
TAEKLMVDLKQKLADLLPLDSQITASWGPAKPSCMEEGIQALAALGYPKSSAERMIAEAM
SELPDHASIAEILPIALKKNLQGLNKS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactatattcgtggtgtgcttacttatatcagttcaggaactatggtaattgaa
agtcagggactggggtttagtatttttgctcctgatagatggcttatggaattgtcaagt
caactacaccgcgagcttatagtctatacttatactgttgttcgtgaaactgagcatgtt
ctctatggatttaatactcgtggagaacgcgagtgtttccgtatgttaatttcattttca
ggagtgggacctaagacaggtttagcgattttaaatacattttctcttagcaaattgtgt
tctatagctcgtgctgaggatatcaaagctatagcttctgttccgggtatagggaagaaa
acagctgagaaacttatggtggatttgaagcaaaagcttgcagacttactccctttagat
tcgcaaatcaccgcttcttggggaccagcaaaaccttcttgtatggaagagggaatacaa
gctttagcagcattaggctatccaaaatcctcagcagagagaatgatcgccgaagctatg
agcgagctcccggatcatgcgtcaatagcagaaattcttcctattgctctaaagaagaat
ttacaaggtttgaacaagagctag

DBGET integrated database retrieval system