KEGG   Chlamydia psittaci WC: B603_0252Help
Entry
B603_0252         CDS       T02313                                 

Definition
uroporphyrinogen-III synthase HemD family protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cpsw  Chlamydia psittaci WC
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cpsw00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(240145..240810)
Genome map
AA seq 221 aa AA seqDB search
MTIYLGLNRETANRYHASFVPILEIIPFARSSPQLRYALRYLEETSHILLTSPSSTSLFI
SRMRRKNSKKTLSTKHYLCLGEITASRLTRLLPKAQYSLATIETGEGVLPMISSLPKNAR
ILYPHSALSRPVIEDFLKRENRSFFAYSHYTIRERQLHPSVFKQCSRVILTSPSGVRAYA
KLFPQLPRRIHICQGPITLKEFREIYNHPGELLQKDSLTES
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaccatatacctaggattaaatcgagaaacagcaaacagataccacgccagcttcgtt
ccgattcttgagatcattccctttgcaagaagctctcctcaactacgttacgccctgcgt
tacctagaagaaacttctcatatcctgctcaccagcccatcttcaacatcactatttatt
tctagaatgcgcagaaaaaattctaaaaagacgttatctaccaaacattacctttgttta
ggagaaatcacagcaagtcgccttacaaggcttctcccaaaagcacaatattccctagct
actattgaaaccggagaaggcgtgctcccaatgatctcctctttacccaaaaacgctcgt
atcctctacccacactcagccttatcgcgtcctgtaattgaagattttttaaaaagagaa
aaccgaagcttttttgcctattcccactacaccattcgagaacgtcaattacacccctct
gtattcaagcagtgcagccgtgtaattttaaccagtccctctggagttagggcgtatgct
aaactcttcccccagctcccaaggagaatacacatctgccaaggcccgatcacacttaaa
gaatttagggaaatttacaaccatcctggggaacttcttcaaaaggacagccttaccgaa
agctga

DBGET integrated database retrieval system