KEGG   Chlamydia psittaci WC: B603_0534Help
Entry
B603_0534         CDS       T02313                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cpsw  Chlamydia psittaci WC
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpsw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(548488..549090)
Genome map
AA seq 200 aa AA seqDB search
MLKYPDYLSKLISFLRKLPGIGFKTAEKLAFELLDWDKDQLESMGKAFSELSAARSHCPT
CFCLKSHPESLCSFCQNNRDTSILCIVATPKDIFALERSQIFKGHYYVLGALLSPITGKH
IDAERMHLLKQRIEFLKPKEIILALDATLEGDATALFLKQELSHSSISISRLALGLPIGL
SFDYIDSGTLARAFSGRNPY
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgctaaagtatcctgactatttatccaaactcatctcctttcttagaaaactccctggg
ataggatttaaaacagcagaaaaactagctttcgaactattagattgggataaggatcaa
ttagaatccatggggaaagctttttccgaactctctgctgcacgcagccattgtcccact
tgtttttgcttgaaaagtcacccagaaagtctttgctcattttgtcaaaacaatcgagac
acatctatattgtgtatcgtagcaactcctaaagatatttttgctttagagcgctcccaa
attttcaaaggtcactattatgtcttaggagccttactatcgccaataacgggaaaacat
attgatgcagagagaatgcatttactaaaacaacgtatagaatttttaaaaccgaaagaa
attattctagctctagacgccactctagaaggagatgctacagcccttttcttaaaacaa
gagctttctcattcctccatatctatttctcgtttggctctaggtttgccaataggattg
tcttttgattatatagactccggaacgcttgctagagccttttctggccgaaacccatat
taa

DBGET integrated database retrieval system