KEGG   Chlamydia psittaci WC: B603_0704Help
Entry
B603_0704         CDS       T02313                                 

Gene name
recD_1
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpsw  Chlamydia psittaci WC
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpsw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    B603_0704 (recD_1)
Enzymes [BR:cpsw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     B603_0704 (recD_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
740351..742555
Genome map
AA seq 734 aa AA seqDB search
MEKISGKLESVLFEDHDSKETAARMRIPYKGTMIVIKGQFPDSFLQLGMQLHVYGKWSEN
PNLGKYFQVYSCDSQEMRDNRGIINYLTSKLIKGIGPKITEKIIEKFRNDTADILDNQPE
RLIEIPGISQTRCDSLCEQLREQKNLRTTLLFLQQYNIAIHYGVKIYKKYKENSIEKICE
DPFLLAREMEGIGFKTADLIATRLGVPLNSQSRLCAGIQYSLEELQEDGHTCYPLQSLAQ
LVEKLLNQDIPEKLIRIEEIISQVYIMQEKNLLHIEELENTPYVWVKHIYLAEKTVVSDL
KRILFSSRKIRPIDSDKAIQWVEENLSIHLEQNQKEAIRACFSEKIHIITGGPGTGKSTI
TKAILKIFEQVTYKIILAAPTGKAAKRMTEITGKHSVTIHALLQYDFKTRSFRKNYENPI
DCDLIIVDESGMMDTYLLYHFLKALPDHVIVIFIGDVHQLPSIGPGNILKDIINSKKITV
TKLNKIFRQVHDSNIIINAHKVNEGEFPVLYSESGRKDFLFFQKEDPQEAVDHIVHLVTQ
FIPKKYHIYPKDIQILAPMKKGVLGIHNLNRVLKSALNPKQATLHGRFHSYAVGDKVMQI
RNNYNKEIFNGDIGYISMINFENKRVVVNMEGKYVVYSFSELDDLVLAYATSVHKYQGSE
SPCIILPIHTSHFMMLYRNLLYTAITRGKQLVVLVGTKKAIAIATRNDKVQHRCTGLLQA
LEQLTQPQYQKHYH
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatttccggaaaattagaaagcgtgctttttgaagatcatgattcaaaggaa
actgctgcacgcatgagaataccctataagggtaccatgatcgttatcaaaggacaattc
cccgattctttcttacagctcggtatgcaactacatgtatacggaaagtggtcagaaaat
cccaacctagggaagtacttccaagtctatagttgtgattctcaagaaatgcgggataat
cgcgggataatcaactaccttacctctaaacttatcaaaggcattgggccaaaaatcaca
gaaaaaatcatcgagaaattccgaaatgacaccgcagatatccttgataatcaacccgaa
agattaatagaaatccccgggattagccaaacacgctgtgatagtctctgtgaacaactc
cgcgagcaaaaaaatcttaggactactctactcttcctacaacagtacaacattgcgatt
cattacggtgtaaaaatctataagaagtataaagagaactctatagaaaaaatatgtgaa
gatccttttcttcttgctagagaaatggagggcatcggatttaaaactgctgatcttata
gcaacacgtcttggcgtgcctttaaactcacaaagccgattatgtgccggaatacaatat
tccctagaagaactccaagaagacggtcatacttgctaccccttacaaagtctggcgcag
ttagtagagaaactactcaatcaagatattccagaaaaactcatacgcattgaagaaatc
atttctcaagtgtacatcatgcaagagaaaaatcttcttcatatcgaagagttagaaaac
accccctacgtgtgggtaaaacatatttacctagcagaaaaaacagtagtttctgattta
aaacgcattttattttcctcaaggaaaatccgccctatagatagcgataaagccattcaa
tgggttgaggaaaacttaagtatacatttagagcaaaaccagaaagaagctattcgtgcg
tgtttttcagaaaaaattcatattattactggaggaccaggaacagggaaaagtaccatc
actaaggctatactcaagatatttgagcaagtgacttataaaatcattttagcagctcct
acaggaaaagctgcaaaacgcatgacagaaattactggaaaacactcggtaactatccat
gcactattacaatatgattttaaaacacggtcttttcgtaagaactacgaaaaccctata
gattgcgatctcatcattgtcgatgaatctggaatgatggatacctatcttttatatcat
ttcttaaaagctcttcctgatcatgtgatcgttatattcattggagatgtacaccaactt
cctagtatcggccctggcaatatcctaaaagatattatcaattctaaaaagattaccgtg
actaagctcaataagattttccgtcaggtccacgactccaacatcattatcaatgctcat
aaagtcaatgaaggtgagttccctgtcctatattctgaatcaggccggaaagatttctta
tttttccaaaaggaagatcctcaagaagctgtagaccatattgtccatctagtgacacag
ttcatccctaagaaataccatatctatcccaaagatattcaaattcttgcgcccatgaaa
aagggggtcttaggaattcataatcttaatcgagtcctaaaatccgctttaaatcctaag
caggcaactctccacgggaggtttcattcctatgctgtaggagataaggttatgcaaatc
cgcaacaactacaataaagaaatatttaatggagatattgggtatatctctatgattaac
tttgaaaataaacgcgttgtagtgaatatggaaggaaagtatgtcgtctattccttctca
gagcttgatgatttggttttagcctatgctacctcagtgcataaataccaaggaagtgaa
agtccgtgtattatcctccctatacacacttcacattttatgatgctttacaggaatctg
ctctacacggccatcacgagaggaaaacaactcgtagtcttagtcggaacgaaaaaagcc
attgctatagccacaagaaatgataaggtacaacaccgctgtacgggactcttgcaagct
cttgaacaacttactcagccccaatatcagaaacattatcattaa

DBGET integrated database retrieval system