KEGG   Chlamydia pneumoniae TW183: CpB0121Help
Entry
CpB0121           CDS       T00136                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cpt  Chlamydia pneumoniae TW183
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cpt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CpB0121
Enzymes [BR:cpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CpB0121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
148770..149276
Genome map
AA seq 168 aa AA seqDB search
MLEQEFSSAFAETISVTTRKPREGEVPGKDYHFVSHEEFQRLLDRQALLEWVFLFGECYG
TSMLEIERIWSLGKHAVAVIDIQGALFIRSRMPSVSIFIAPPSQEELERRLASRGSEEGS
QRKERLEHSLIELAAANQFDYVIINDDLNQAYRVLKSIFIAEEHRNIL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgttagagcaagagttttcttctgcttttgctgagactatatcggtaacaacaaggaaa
cctcgagagggtgaagtcccaggtaaagattatcattttgtttcccacgaagaatttcaa
agacttttggatcgtcaggctctcttagaatgggtgttcttattcggagagtgttacgga
acaagtatgttagagattgaaagaatttggagcctagggaagcacgctgttgctgttatt
gatatccaaggagccttgtttattcgctctcggatgcctagtgtatctatttttattgct
ccaccttcacaggaggagttagaaagaaggttagcttcacggggatctgaagagggctct
caaagaaaagaacggctggagcacagtcttattgagctagcagctgcaaatcagtttgat
tatgtcattattaacgacgacttaaatcaagcgtacagggttttaaaaagcatttttata
gctgaagaacataggaacatattatga

DBGET integrated database retrieval system