KEGG   Chlamydia pneumoniae TW183: CpB0124Help
Entry
CpB0124           CDS       T00136                                 

Definition
exodeoxyribonuclease V
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cpt  Chlamydia pneumoniae TW183
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cpt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CpB0124
Enzymes [BR:cpt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CpB0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(151266..153464)
Genome map
AA seq 732 aa AA seqDB search
MEKICGYLEQILVENKDSGDITAYIKIPNKTTPILIKGKLPQPLELGSPIQIYGVWSHSP
SNTKYFQIHSYDSPLLYEYRGVFHYLTSKLIKGIGPKIAEKIIEKFQEKTCYVLDITPER
LSEVSGISETRCVSICKQLCEQKILRKTLLFLQEYNIPIHYGVRIFKKYQEKSIEKICED
PFLLAREMEGIGFKTADFIAMKLGVPRNSESRLCAGIQHSLEELQEEGHTCYPIELLIDV
VAKLLNQDVFDTPITLEEIDTQILNMQKRKLLHIQDISGTLHVWTRYLHLAEKTIVSDLK
RILFSSRRIRSIDGEKAIAWVEENLSIDLAEQQREAIKACFSEKLLIITGGPGTGKSTIT
QAILKIFEQVTHKIILAAPTGKAAKRMTEITQKHSVTIHALLQYDFKTKSFRKNHDNPID
CDLIIVDESGMMDTHLLHHFLKALPDYTTLVFIGDIHQLPSVGPGNILKDLITSNKMTVI
RLNKIFRQVHDSGIVTNAHRVNEGELPILYSETGRRDFLFFQKDDQEEALNHIIHLVTKF
VPQKYHIYPQDIQVLAPMKKGTLGIYNLNKALKHALNPKKANLHGRFQSYAVGDKVMQIR
NNYNKEVFNGDIGYVSTINFEDKAVVVRMEGKHVGYSFSELDDLVLAYATSVHKYQGSES
PCIIIPIHTSHFMMLYRNLLYTAITRGKKLVILVGTKKAIAIATRNNRVQHRCTGLAEVL
KELDTKKNYADL
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatctgcggatacttagagcaaatacttgttgaaaacaaagactctggggac
attactgcttatatcaaaatacccaataaaacgactcctatcctaattaaaggcaaactt
ccccaacctttggaactaggatccccaatccaaatctatggtgtctggagccattcccct
tcaaatactaagtatttccaaatccatagttacgactctcctcttctttatgaatatcgt
ggcgtattccattacctcacctcaaaactcatcaaaggaatcggccctaaaatcgcagaa
aagatcatcgagaaatttcaagagaaaacatgttatgtcctcgatatcactccagaacgc
ttaagtgaggtttctggaattagcgaaacacgatgtgtctctatttgcaaacaactctgc
gagcaaaaaatcttaaggaaaactcttctctttctccaagaatacaatatcccgattcat
tatggagtgagaatttttaaaaaataccaagagaaatccatagaaaaaatttgcgaagat
cccttccttctagccagagaaatggagggcatcggattcaaaactgctgatttcatagct
atgaaactaggcgtccccagaaattctgaaagtcgcctatgtgctggtatccagcactcc
ttagaagaacttcaagaagaaggtcatacttgctatccgatagagctcctgatagatgtc
gtcgccaaactattaaatcaagatgtctttgatactcctattactctcgaagaaatcgat
acgcaaatcctcaatatgcaaaagcgtaagcttttacatattcaagacatttctgggaca
ctccatgtctggacacgttatctccatctcgcagagaaaactattgtttctgatctcaag
cgcattttattttcttcgaggagaatccgttctatagacggagaaaaagcaattgcttgg
gtagaggaaaacctaagtatagatctcgcagaacaacaacgagaagcaattaaagcctgt
ttttctgaaaaacttctcatcattactgggggccctggaactggaaaaagtaccattacc
caagcaatactgaaaatttttgaacaggtgactcataaaatcatcctcgcagctcctaca
ggaaaagccgctaaacggatgaccgaaattacacaaaaacactccgtcaccattcatgct
ctgctacagtatgattttaaaacgaaatctttccgcaagaaccatgacaatcctatagac
tgtgatctgatcattgttgacgaatccggaatgatggacacgcacttgctgcaccacttc
ctgaaagcacttcctgactacacaactcttgtctttattggagacattcaccagctaccc
agcgtgggcccaggaaatatccttaaagacttgattacttcgaataaaatgacagtcatc
agattaaataagatcttccgccaagttcatgattcgggaatcgttacgaatgcccatagg
gtaaatgaaggggaactccccatattatattcagaaacagggcgtcgtgatttcttattt
ttccaaaaggatgatcaagaagaggctctcaatcatatcattcatcttgtgacaaaattc
gtcccacaaaaataccatatctatcctcaagatatccaagtactagctcccatgaaaaaa
ggaaccctaggaatctataatctaaataaagcactcaaacatgcattaaaccctaaaaaa
gcaaatcttcacggtagatttcaatcctatgccgttggcgataaggtaatgcaaatccgc
aacaactataataaagaagtctttaacggcgatataggctatgtctctacaatcaacttc
gaagataaagctgttgttgtccgtatggaaggaaagcatgtcggctattctttctcagag
cttgacgatctagtcttagcctatgctacctcagtacataagtaccagggaagtgaaagc
ccctgcattatcattcctattcatacctcgcactttatgatgctctatagaaatcttctc
tatactgctattacgcgggggaaaaaattggtgattctagttgggacaaaaaaagccatt
gctattgcaacaagaaataatcgagtgcaacaccgatgtacaggactagcagaagttctt
aaagagctcgatactaagaaaaattatgcagatctgtaa

DBGET integrated database retrieval system