KEGG   Chlamydia pneumoniae TW183: CpB0212Help
Entry
CpB0212           CDS       T00136                                 

Definition
(GenBank) pyrophosphate-dependent phosphofructokinase beta subunit
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cpt  Chlamydia pneumoniae TW183
Pathway
cpt00010  Glycolysis / Gluconeogenesis
cpt00030  Pentose phosphate pathway
cpt00051  Fructose and mannose metabolism
cpt00680  Methane metabolism
cpt01100  Metabolic pathways
cpt01110  Biosynthesis of secondary metabolites
cpt01120  Microbial metabolism in diverse environments
cpt01130  Biosynthesis of antibiotics
cpt01200  Carbon metabolism
cpt01230  Biosynthesis of amino acids
cpt03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:cpt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CpB0212
   00030 Pentose phosphate pathway
    CpB0212
   00051 Fructose and mannose metabolism
    CpB0212
   00052 Galactose metabolism
    CpB0212
  Energy metabolism
   00680 Methane metabolism
    CpB0212
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CpB0212
Enzymes [BR:cpt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CpB0212
Protein phosphatases and associated proteins [BR:cpt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CpB0212
Messenger RNA biogenesis [BR:cpt03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CpB0212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AAP98145
Position
246360..248012
Genome map
AA seq 550 aa AA seqDB search
MHPLYVDLDTIISSYSPPLPKEFQEAASLIAVPDTSHSKPVVPGVKTLFPQTYHLPYLKF
VQGENVVHTPLKVGVMFSGGPAPGGHNVIQGLFNSLKDFHPDSSLVGFVNNGDGLTNNKS
IDITEEFLSKFRNSGGFNCIGTGRKKIVTPEAKEACLKTAEALDLDGLVIIGGDGSNTAT
AILAEYFAKRRPKTSIVGVPKTIDGDLQHTFLDLTFGFDTATKFYSSIISNISRDALSCK
AHYHFIKLMGRSASHIALECALQTHPNIALIGEEIAEKNLPLKTIIHKICSVIADRAAME
KYYGVILIPEGIIEFIPEIINLITEIESLSEYEDKISRLSPESQRLLKSFPAPIIEQILN
DRDAHGNVYVSKISVDKLLIHLVSNHLQQYFPNVPFNAISHFLGYEGRSGLPTKFDNTYG
YSLGYGAGILVRNHCNGYLSTIESLACPFMKWKLRAIPVVKMFTVKQQADGTLQPKIKKY
LVDIGSTAFRKFKLYRKIWALEDSYRFLGPLQIETPPEMHSDNFPPLTLLLNHNFWQRHQ
GCIEIPDTTY
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcatcctttatacgttgatcttgatactattatcagctcctactctcctcccttacct
aaagaatttcaagaagcagcctctttaattgctgttccagatacttcacattctaagcct
gtcgttccaggagtgaaaaccctctttccacaaacctaccaccttccctatctaaagttt
gtccaaggagaaaatgtcgttcacactcctctaaaagtaggcgtaatgttctcaggagga
cctgctccaggaggacataatgtcatccaaggactcttcaatagtctaaaagatttccat
cccgattcctccctcgtggggttcgtaaataatggagacggtcttacaaacaataaaagc
atagacattactgaagagtttctctccaaattccgaaattccggaggcttcaactgtata
ggaacaggaaggaaaaaaattgtaactccagaagctaaagaggcttgtctaaagaccgca
gaggctctggatctcgacggactagtcattattggcggtgatggctccaatacagcaacc
gctattcttgcagagtattttgcaaaacgacgcccaaaaacctctattgtcggagttcct
aaaactatagatggggatctacaacacaccttcttggatctgaccttcggatttgatact
gcaacaaaattctactcttcaatcattagcaatatttcaagagatgctctttcctgtaaa
gctcattaccacttcattaaacttatgggacgctcagcatcccatattgctttggaatgt
gctctccaaactcatccaaatattgcccttatcggcgaagaaattgccgaaaaaaatcta
ccactaaaaaccatcatccataaaatctgctccgtaattgcagatagagccgctatggaa
aaatactatggcgtcatcctcatcccagaaggcattatcgagttcatcccagaaatcatc
aacttaattacagaaatcgaaagcctatcagaatacgaagataaaatctccaggctctct
ccagaatcccaacgcctactgaaaagcttcccagcacctatcatcgagcaaatcctcaat
gaccgcgatgctcacggtaatgtctatgtttctaaaattagtgtcgataaactactcatc
cacctggtcagcaatcatctccaacaatatttccctaacgtccctttcaatgcgatctca
cattttctaggatatgaaggacgctcgggattgcctacaaaattcgataatacctacggc
tatagcctcggatacggcgccggtattctcgtccgcaatcactgcaacggctatctctct
actatagaatccctagcatgccctttcatgaaatggaaattacgggcaattcccgtagtg
aaaatgttcacagtaaaacaacaggcagatggaactctacaacctaaaattaaaaaatac
ctcgtagatataggaagcacggcatttcgtaaatttaagctctataggaaaatttgggcc
ctcgaagactcctaccgattcctagggcctctacaaatagaaactcctccagaaatgcac
tctgataatttccctcctcttacccttttgcttaatcataacttttggcaacgtcaccag
ggttgcatagaaatccctgatactacgtattaa

DBGET integrated database retrieval system