KEGG   Chlamydia pneumoniae TW183: CpB0308Help
Entry
CpB0308           CDS       T00136                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cpt  Chlamydia pneumoniae TW183
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cpt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
334230..334832
Genome map
AA seq 200 aa AA seqDB search
MTRYPDYLSKLIFFLRKLPGIGFKTAEKLAFELISWDSEQLKILGNAFHNVASERSHCPL
CFTLKESKEADCHFCREERDNQSLCIVASPKDVFFLERSKVFKGRYHVLGSLLSPITGKH
IENERLSILKSRIETLCPKEIILAIDATLEGDATALFLKQELQHFSVNISRLALGLPIGL
SFDYVDSGTLARAFSGRHSY
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacaagatatccagattacttatctaaattaattttctttttacgaaaacttccagga
attggatttaaaacagcagaaaaacttgcttttgaactcatctcttgggacagcgaacaa
ttaaaaatattaggtaacgcttttcataatgttgctagtgagcgtagtcactgtccccta
tgttttactctcaaagaatctaaagaggcagactgtcacttttgtagagaagaaagagat
aaccaaagtctatgtattgtcgcttctccaaaagatgttttctttctagaacgttctaaa
gtattcaagggacgttatcatgttcttggttcactcttatcgcccattacagggaaacat
atagaaaacgagcgtctctccattttaaaatcacgcatagaaacgctatgcccaaaagaa
attatcctagccattgatgcaaccttagaaggagatgctactgccctttttctaaaacaa
gaattacaacatttctctgtaaatatttcccgtctagctttaggtcttcctataggctta
tcttttgattatgtagattcagggacactggcaagagctttttctggacgacactcctat
tag

DBGET integrated database retrieval system